PDB entry 3no2

View 3no2 on RCSB PDB site
Description: Crystal structure of a protein of unknown function (BACCAC_01654) from Bacteroides caccae at 1.35 A resolution
Deposited on 2010-06-24, released 2010-07-28
The last revision was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.147
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Bacteroides caccae [TaxId:411901]
    Gene: BACCAC_01654, ZP_01960044.1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, CIT, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3no2A (A:)
    gsspqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkageilfsyskgakm
    itrdgrelwniaapagcemqtarilpdgnalvawcghpstilevnmkgevlsktefetgi
    erphaqfrqinknkkgnylvplfatsevreiapngqllnsvklsgtpfssafldngdclv
    acgdahcfvqlnlesnrivrrvnandiegvqlffvaqlfplqngglyicnwqghdreagk
    gkhpqlveidsegkvvwqlndkvkfgmisticpire
    

    Sequence, based on observed residues (ATOM records):
    >3no2A (A:)
    spqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkageilfsyskgakmit
    rdgrelwniaapagcemqtarilpdgnalvawcghpstilevnmkgevlsktefetgier
    phaqfrqinknkkgnylvplfatsevreiapngqllnsvklsgtpfssafldngdclvac
    gdahcfvqlnlesnrivrrvnandiegvqlffvaqlfplqngglyicnwqghdreagkgk
    hpqlveidsegkvvwqlndkvkfgmisticpire