PDB entry 3nnw

View 3nnw on RCSB PDB site
Description: Crystal structure of P38 alpha in complex with DP802
Class: transferase
Keywords: kinase, TRANSFERASE
Deposited on 2010-06-24, released 2010-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.169
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nnwa_
  • Heterogens: EDD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nnwA (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nnwA (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
    atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
    aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
    ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp