PDB entry 3nns

View 3nns on RCSB PDB site
Description: BeF3 Activated DrrB Receiver Domain
Class: DNA binding protein
Keywords: CheY-like fold, alpha/beta, DNA BINDING PROTEIN
Deposited on 2010-06-24, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA binding response regulator b
    Species: Thermotoga maritima [TaxId:2336]
    Gene: DrrB, TM_0126
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nnsa_
  • Chain 'B':
    Compound: DNA binding response regulator b
    Species: Thermotoga maritima [TaxId:2336]
    Gene: DrrB, TM_0126
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nnsb_
  • Heterogens: MG, BEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nnsA (A:)
    mmwkiavvdddknilkkvseklqqlgrvktfltgedflndeeafhvvvldvmlpdysgye
    icrmiketrpetwvilltllsddesvlkgfeagaddyvtkpfnpeillarvkrfler
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nnsB (B:)
    mmwkiavvdddknilkkvseklqqlgrvktfltgedflndeeafhvvvldvmlpdysgye
    icrmiketrpetwvilltllsddesvlkgfeagaddyvtkpfnpeillarvkrfler