PDB entry 3nnr

View 3nnr on RCSB PDB site
Description: crystal structure of a tetr-family transcriptional regulator (maqu_3571) from marinobacter aquaeolei vt8 at 2.49 a resolution
Deposited on 2010-06-24, released 2010-07-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TRANSCRIPTIONAL REGULATOR, TetR FAMILY
    Species: Marinobacter aquaeolei [TaxId:351348]
    Gene: Maqu_3571
    Database cross-references and differences (RAF-indexed):
  • Heterogens: UNL, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nnrA (A:)
    gmtmktrdkillsslelfndkgernittnhiaahlaispgnlyyhfrnksdiiyeifqey
    eklvdyyldipedrpitledmtfylesvfdglwsyrffhrdleylldsdprlrqdyreft
    nrclaainrifakladagiiqpqpedlrsamslnvwlvitnwmaflktahaaeepaslsl
    telkqgiyqvltlevpyltpeyrervlalrekyrptlpeaqgisgvea
    

    Sequence, based on observed residues (ATOM records):
    >3nnrA (A:)
    mktrdkillsslelfndkgernittnhiaahlaispgnlyyhfrnksdiiyeifqeyekl
    vdyyldipedrpitledmtfylesvfdglwsyrffhrdleylldsdprlrqdyreftnrc
    laainrifakladagiiqpqpedlrsamslnvwlvitnwmaflktahltelkqgiyqvlt
    levpyltpeyrervlalrekyrp