PDB entry 3nnp

View 3nnp on RCSB PDB site
Description: Native structure of XometC, a cystathionine c-lyase protein from Xanthomonas oryzae pv.oryzae, at pH 5.2
Class: lyase
Keywords: XometC, lyase, native, Cys-met metabolism PLP-dependent enzyme family, cystathionine gamma lyase, Pyridoxal-phosphate (PLP)
Deposited on 2010-06-24, released 2010-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.21
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nnpa_
  • Chain 'B':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nnpb_
  • Heterogens: PLP, GOL, BCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nnpA (A:)
    gshmsnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfe
    ysrthnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfr
    lfervrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviark
    hglltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaf
    lqnsiggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashp
    qhvlakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthas
    ipvarreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nnpA (A:)
    alslatlaihggqspdpstgavmppiyatstyaqsrthnptrfayercvaaleggtrafa
    fasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsfvdltdpaafka
    airadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspmlqrplslgadlv
    vhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsflalrglktlplr
    mrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggivsivlkggfdaa
    krfcektelftlaeslggveslvnhpavmteqlgisdalvrlsvgiedlgdlrgdleral
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nnpB (B:)
    gshmsnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfe
    ysrthnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfr
    lfervrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviark
    hglltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaf
    lqnsiggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashp
    qhvlakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthas
    ipvarreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nnpB (B:)
    lslatlaihggqspdpstgavmppiyatstyaqsspsrthnptrfayercvaaleggtra
    fafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsfvdltdpaaf
    kaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspmlqrplslgad
    lvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsflalrglktlp
    lrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggivsivlkggfd
    aakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalvrlsvgiedl
    gdlrgdleralv