PDB entry 3nno

View 3nno on RCSB PDB site
Description: Crystal structure of the complex of peptidoglycan recognition protein (PGRP-S) with Alpha-Rhamnose at 2.9 A resolution
Class: antibiotic
Keywords: Peptidoglycan Binding, Immune response, secreted, antimicrobial, PGRP, Antibiotic
Deposited on 2010-06-24, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.185
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nnoa_
  • Chain 'B':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nnob_
  • Chain 'C':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nnoc_
  • Chain 'D':
    Compound: Peptidoglycan recognition protein 1
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nnod_
  • Heterogens: TLA, RAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nnoA (A:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nnoB (B:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nnoC (C:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nnoD (D:)
    edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
    vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
    lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra