PDB entry 3nnn

View 3nnn on RCSB PDB site
Description: BeF3 Activated DrrD Receiver Domain
Class: DNA binding protein
Keywords: CheY-like fold, alpha/beta, DNA BINDING PROTEIN
Deposited on 2010-06-23, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA binding response regulator d
    Species: Thermotoga maritima [TaxId:2336]
    Gene: DRRD, TM_0399
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nnna_
  • Chain 'B':
    Compound: DNA binding response regulator d
    Species: Thermotoga maritima [TaxId:2336]
    Gene: DRRD, TM_0399
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nnnb_
  • Heterogens: MG, BEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nnnA (A:)
    mnvrvlvvederdladlitealkkemftvdvcydgeegmymalnepfdvvildimlpvhd
    gweilksmresgvntpvlmltalsdveyrvkglnmgaddylpkpfdlreliarvralirr
    ks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nnnA (A:)
    nvrvlvvederdladlitealkkemftvdvcydgeegmymalnepfdvvildimlpvhdg
    weilksmresgvntpvlmltalsdveyrvkglnmgaddylpkpfdlreliarvralirr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nnnB (B:)
    mnvrvlvvederdladlitealkkemftvdvcydgeegmymalnepfdvvildimlpvhd
    gweilksmresgvntpvlmltalsdveyrvkglnmgaddylpkpfdlreliarvralirr
    ks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nnnB (B:)
    nvrvlvvederdladlitealkkemftvdvcydgeegmymalnepfdvvildimlpvhdg
    weilksmresgvntpvlmltalsdveyrvkglnmgaddylpkpfdlreliarvralirr