PDB entry 3nnk

View 3nnk on RCSB PDB site
Description: Biochemical and Structural Characterization of a Ureidoglycine Aminotransferase in the Klebsiella pneumoniae Uric Acid Catabolic Pathway
Deposited on 2010-06-23, released 2010-07-07
The last revision was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.219
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Ureidoglycine-glyoxylate aminotransferase
    Species: Klebsiella pneumoniae [TaxId:272620]
    Gene: hpxJ
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nnkA (A:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nnkB (B:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkB (B:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgde
    emiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgda
    lvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkv
    wrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nnkC (C:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkC (C:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgde
    emiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgda
    lvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkv
    wrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nnkD (D:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkD (D:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgde
    emiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgda
    lvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkv
    wrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nnkE (E:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkE (E:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgde
    emiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgda
    lvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkv
    wrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3nnkF (F:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkF (F:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgde
    emiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgda
    lvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkv
    wrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3nnkG (G:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkG (G:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgde
    emiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgda
    lvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkv
    wrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3nnkH (H:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkH (H:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgde
    emiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgda
    lvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkv
    wrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >3nnkJ (J:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkJ (J:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgde
    emiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgda
    lvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkv
    wrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >3nnkK (K:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkK (K:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgde
    emiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgda
    lvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkv
    wrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >3nnkL (L:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkL (L:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegrtdahrdgdee
    miysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgdal
    vkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkvw
    rigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >3nnkM (M:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkM (M:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgde
    emiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgda
    lvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkv
    wrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'O':
    Sequence, based on SEQRES records:
    >3nnkO (O:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkO (O:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgde
    emiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgda
    lvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkv
    wrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'P':
    Sequence, based on SEQRES records:
    >3nnkP (P:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkP (P:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgde
    emiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgda
    lvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkv
    wrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >3nnkR (R:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkR (R:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgde
    emiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgda
    lvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkv
    wrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

  • Chain 'S':
    Sequence, based on SEQRES records:
    >3nnkS (S:)
    mditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfr
    tenrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievp
    wgevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslg
    gnpletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgd
    eemiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgd
    alvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgk
    vwrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser
    

    Sequence, based on observed residues (ATOM records):
    >3nnkS (S:)
    ditqfsqlnppsrllmgpgpinadprvlramssqligqydpamthymnevmalyrgvfrt
    enrwtmlvdgtsragieailvsairpgdkvlvpvfgrfghllceiarrcraevhtievpw
    gevftpdqvedavkrirprllltvqgdtsttmlqplaelgeicrrydalfytdataslgg
    npletdvwgldavsagmqkclggpsgtspitlsarmeeairrrkcveegirtdahrdgde
    emiysnyfdlgmvmdywgperlnhhteattalfgarecarlilqegldygiarhklhgda
    lvkgiqamgletfgdlkhkmnnvlgvvipqgingdqarklmledfgieigtsfgplhgkv
    wrigtmgynarkdcvmttlsaleavlnylkfpttqgaamqaawdhyrser