PDB entry 3nnh

View 3nnh on RCSB PDB site
Description: crystal structure of the cugbp1 rrm1 with guuguuuuguuu rna
Deposited on 2010-06-23, released 2010-10-27
The last revision was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.191
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CUGBP Elav-like family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BRUNOL2, CELF1, CUGBP, CUGBP1, NAB50
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: CUGBP Elav-like family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BRUNOL2, CELF1, CUGBP, CUGBP1, NAB50
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: CUGBP Elav-like family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BRUNOL2, CELF1, CUGBP, CUGBP1, NAB50
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: CUGBP Elav-like family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BRUNOL2, CELF1, CUGBP, CUGBP1, NAB50
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: RNA (5'-r(*gp*up*up*gp*up*up*up*up*gp*up*up*u)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'F':
    Compound: RNA (5'-r(*gp*up*up*gp*up*up*up*up*gp*up*up*u)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nnhA (A:)
    sdaikmfvgqvprtwsekdlrelfeqygavyeinvlrdrsqnppqskgccfvtfytrkaa
    leaqnalhnmkvlpgmhhpiqmkpadse
    

    Sequence, based on observed residues (ATOM records):
    >3nnhA (A:)
    daikmfvgqvprtwsekdlrelfeqygavyeinvlrdrsqnppqskgccfvtfytrkaal
    eaqnalhnmkvlpgmhhpiqmkpads
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nnhB (B:)
    sdaikmfvgqvprtwsekdlrelfeqygavyeinvlrdrsqnppqskgccfvtfytrkaa
    leaqnalhnmkvlpgmhhpiqmkpadse
    

    Sequence, based on observed residues (ATOM records):
    >3nnhB (B:)
    daikmfvgqvprtwsekdlrelfeqygavyeinvlrdrsqnppqskgccfvtfytrkaal
    eaqnalhnmkvlpgmhhpiqmkpads
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nnhC (C:)
    sdaikmfvgqvprtwsekdlrelfeqygavyeinvlrdrsqnppqskgccfvtfytrkaa
    leaqnalhnmkvlpgmhhpiqmkpadse
    

    Sequence, based on observed residues (ATOM records):
    >3nnhC (C:)
    daikmfvgqvprtwsekdlrelfeqygavyeinvlrdrsqnppqskgccfvtfytrkaal
    eaqnalhnmkvlpgmhhpiqmkpad
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nnhD (D:)
    sdaikmfvgqvprtwsekdlrelfeqygavyeinvlrdrsqnppqskgccfvtfytrkaa
    leaqnalhnmkvlpgmhhpiqmkpadse
    

    Sequence, based on observed residues (ATOM records):
    >3nnhD (D:)
    daikmfvgqvprtwsekdlrelfeqygavyeinvlrdrsqnppqskgccfvtfytrkaal
    eaqnalhnmkvlpgmhhpiqmkpadse
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.