PDB entry 3nng

View 3nng on RCSB PDB site
Description: crystal structure of the f5/8 type c domain of q5lfr2_bacfn protein from bacteroides fragilis. northeast structural genomics consortium target bfr258e
Deposited on 2010-06-23, released 2010-08-18
The last revision was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.167
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF1314
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LFR2 (Start-159)
      • engineered (157)
      • expression tag (160)
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Bacteroides fragilis [TaxId:272559]
    Gene: BF1314
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5LFR2 (Start-159)
      • engineered (157)
      • expression tag (160)
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nngA (A:)
    msvlytsytkpgnwsavdrsawsvscsnvyadddakygahlaidgeinttwftwgvanag
    ecwwntvldrpvtltgfsvtkqsaygsgynlrsaeikvrkegetewvtyprvltfrnfkg
    adpqyaaieppipnvkefrincltpdnytgfaeinlyekqlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nngA (A:)
    tkpgnwsavdrsawsvscsnvyadddakygahlaidgeinttwftwgvanagecwwntvl
    drpvtltgfsvtkqsaygsgynlrsaeikvrkegetewvtyprvltfrnfkgadpqyaai
    eppipnvkefrincltpdnytgfaeinlyekql
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nngB (B:)
    msvlytsytkpgnwsavdrsawsvscsnvyadddakygahlaidgeinttwftwgvanag
    ecwwntvldrpvtltgfsvtkqsaygsgynlrsaeikvrkegetewvtyprvltfrnfkg
    adpqyaaieppipnvkefrincltpdnytgfaeinlyekqlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nngB (B:)
    pgnwsavdrsawsvscsnvyadddakygahlaidgeinttwftwgvanagecwwntvldr
    pvtltgfsvtkqsaygsgynlrsaeikvrkegetewvtyprvltfrnfkgadpqyaaiep
    pipnvkefrincltpdnytgfaeinlyekql