PDB entry 3nnf

View 3nnf on RCSB PDB site
Description: halogenase domain from cura module with fe, chloride, and alpha- ketoglutarate
Deposited on 2010-06-23, released 2010-07-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CurA
    Species: Lyngbya majuscula [TaxId:158786]
    Gene: curA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE, FMT, AKG, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nnfA (A:)
    mhhhhhhssgvdlgtenlyfqsnamnreqveqlkqeyeekgycqikkifdfsaiktiqkt
    ldqakqesqiskekvtlklggiddidtndhaydlvkydfvssfiqeklallnyitgknlm
    imhnalfsvepnhkglpwhvgvgsfsftktedfgasiwipldkitkehrggmqyvstkif
    pgqfyysvfdlhlknnikwdesqgdlneyvanantiynkitedvidytikdgyeedeynl
    gdafffnkyvlhqsvplkpglhklrrafvirlvdydtrvdeerlglfskysqlhsryykt
    lprynkdsvlvmvsravqkglkspylrdiphvqqtlaarmaaga
    

    Sequence, based on observed residues (ATOM records):
    >3nnfA (A:)
    mnreqveqlkqeyeekgycqikkifdfsaiktiqktldqakqesqiskekvtlklggidd
    idtndhaydlvkydfvssfiqeklallnyitgknlmimhnalfsvepnhkglpwhvgvgs
    fsftktedfgasiwipldkitkehrggmqyvstkifpgqfyysvfdlhlknnikwdesqg
    dlneyvanantiynkitedvidytikdgyeedeynlgdafffnkyvlhqsvplkpglhkl
    rrafvirlvdydtrvdeerlglfskysqlhsryyktlprynkdsvlvmvsravqkglksp
    ylrdiphvqqtlaarmaa