PDB entry 3nne

View 3nne on RCSB PDB site
Description: Crystal structure of choline oxidase S101A mutant
Deposited on 2010-06-23, released 2010-07-28
The last revision was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: 0.231
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: choline oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Gene: codA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7X2H8 (0-End)
      • engineered mutation (100)
  • Chain 'B':
    Compound: choline oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Gene: codA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7X2H8 (0-End)
      • engineered mutation (100)
  • Chain 'C':
    Compound: choline oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Gene: codA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7X2H8 (0-End)
      • engineered mutation (100)
  • Chain 'D':
    Compound: choline oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Gene: codA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7X2H8 (0-End)
      • engineered mutation (100)
  • Chain 'E':
    Compound: choline oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Gene: codA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7X2H8 (0-End)
      • engineered mutation (100)
  • Chain 'F':
    Compound: choline oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Gene: codA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7X2H8 (0-End)
      • engineered mutation (100)
  • Chain 'G':
    Compound: choline oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Gene: codA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7X2H8 (0-End)
      • engineered mutation (100)
  • Chain 'H':
    Compound: choline oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Gene: codA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7X2H8 (0-End)
      • engineered mutation (100)
  • Heterogens: FAD, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nneA (A:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsaragetttadae
    lsaala
    

    Sequence, based on observed residues (ATOM records):
    >3nneA (A:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsar
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nneB (B:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsaragetttadae
    lsaala
    

    Sequence, based on observed residues (ATOM records):
    >3nneB (B:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsar
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nneC (C:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsaragetttadae
    lsaala
    

    Sequence, based on observed residues (ATOM records):
    >3nneC (C:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirs
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nneD (D:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsaragetttadae
    lsaala
    

    Sequence, based on observed residues (ATOM records):
    >3nneD (D:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsar
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nneE (E:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsaragetttadae
    lsaala
    

    Sequence, based on observed residues (ATOM records):
    >3nneE (E:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsar
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3nneF (F:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsaragetttadae
    lsaala
    

    Sequence, based on observed residues (ATOM records):
    >3nneF (F:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsar
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3nneG (G:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsaragetttadae
    lsaala
    

    Sequence, based on observed residues (ATOM records):
    >3nneG (G:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsa
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3nneH (H:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsaragetttadae
    lsaala
    

    Sequence, based on observed residues (ATOM records):
    >3nneH (H:)
    mhidnienlsdrefdyivvgggsagaavaarlsedpavsvalveagpddrgvpevlqldr
    wmellesgydwdypiepqengnsfmrharakvmggcsshnaciafwapredldeweakyg
    atgwnaeaawplykrletnedagpdaphhgdsgpvhlmnvppkdptgvalldaceqagip
    rakfntgttvvnganffqinrradgtrssssvsyihpiveqenftlltglrarqlvfdad
    rrctgvdivdsafghthrltarnevvlstgaidtpkllmlsgigpaahlaehgievlvds
    pgvgehlqdhpegvvqfeakqpmvaestqwweigiftptedgldrpdlmmhygsvpfdmn
    tlrhgypttengfsltpnvtharsrgtvrlrsrdfrdkpmvdpryftdpeghdmrvmvag
    irkareiaaqpamaewtgrelspgveaqtdeelqdyirkthntvyhpvgtvrmgavedem
    spldpelrvkgvtglrvadasvmpehvtvnpnitvmmigercadlirsar