PDB entry 3nnd

View 3nnd on RCSB PDB site
Description: The crystal structure of ABC transporter from Rhodopseudomonas palustris
Class: transport protein
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, ABC transporter, SGX, TRANSPORT PROTEIN
Deposited on 2010-06-23, released 2010-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.246
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Possible substrate binding protein of ABC transporter system
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: RPA4397
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N1K8 (Start-357)
      • expression tag (358-359)
    Domains in SCOPe 2.07: d3nnda1, d3nnda2
  • Chain 'B':
    Compound: Possible substrate binding protein of ABC transporter system
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: RPA4397
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nndb_
  • Chain 'C':
    Compound: Possible substrate binding protein of ABC transporter system
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: RPA4397
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nndc_
  • Chain 'D':
    Compound: Possible substrate binding protein of ABC transporter system
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: RPA4397
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nndd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nndA (A:)
    msladdlkialiygktgpleayakqtetglmmgleyatkgtmtldgrkivvitkddqskp
    dlskaalaeayqddgadiaigtsssaaaladlpvaeenkkilivepavadqitgekwnry
    ifrtgrnssqdaisnavaigkqgvtiatlaqdyafgrdgvaafkealaktgatlateeyv
    pttttdftavgqrlfdalkdkpgkkiiwviwagggdpltklqdmdpkrygielstggnil
    palaaykrlpgmegatyyyydipknpinewlvtehqkrfnappdfftaggfsaamavvta
    vqkakstdtekliaamegmefdtpkgkmvfrkedhqalqsmyhfkvkvdpavawavleeg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nndA (A:)
    dlkialiygktgpleayakqtetglmmgleyatkgtmtldgrkivvitkddqskpdlska
    alaeayqddgadiaigtsssaaaladlpvaeenkkilivepanryifrtgrnssqdaisn
    avaigkqgvtiatlaqdyafgrdgvaafkealaktgatlateeyvpttttdftavgqrlf
    dalkdkpgkkiiwviwapltklqdmdpkrygielstggnilpalaaykrlmegatyyyyd
    ipknpinewlvtehqkrfnappdfftaggfsaamavvtavqkakstdtekliaamegmef
    dtpkgkmvfrkedhqalqsmyhfkvkvdpavawavleeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nndB (B:)
    msladdlkialiygktgpleayakqtetglmmgleyatkgtmtldgrkivvitkddqskp
    dlskaalaeayqddgadiaigtsssaaaladlpvaeenkkilivepavadqitgekwnry
    ifrtgrnssqdaisnavaigkqgvtiatlaqdyafgrdgvaafkealaktgatlateeyv
    pttttdftavgqrlfdalkdkpgkkiiwviwagggdpltklqdmdpkrygielstggnil
    palaaykrlpgmegatyyyydipknpinewlvtehqkrfnappdfftaggfsaamavvta
    vqkakstdtekliaamegmefdtpkgkmvfrkedhqalqsmyhfkvkvdpavawavleeg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nndB (B:)
    dlkialiygktgpleayakqtetglmmgleyatkgtmtldgrkivvitkddqskpdlska
    alaeayqddgadiaigtsssaaaladlpvaeenkkilivepanryifrtgrnssqdaisn
    avaigkqgvtiatlaqdyafgrdgvaafkealaktgatlateeyvpttdftavgqrlfda
    lkdkpgkiiwviwapltklqdmdkrygielstggnilpalaaygmegatyyyydipknpi
    newlvtehqkrfnappdfftaggfsaamavvtavqkakstdtekliaamegmefdtpkgk
    mvfrkedhqalqsmyhfkvkvdpavawavl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nndC (C:)
    msladdlkialiygktgpleayakqtetglmmgleyatkgtmtldgrkivvitkddqskp
    dlskaalaeayqddgadiaigtsssaaaladlpvaeenkkilivepavadqitgekwnry
    ifrtgrnssqdaisnavaigkqgvtiatlaqdyafgrdgvaafkealaktgatlateeyv
    pttttdftavgqrlfdalkdkpgkkiiwviwagggdpltklqdmdpkrygielstggnil
    palaaykrlpgmegatyyyydipknpinewlvtehqkrfnappdfftaggfsaamavvta
    vqkakstdtekliaamegmefdtpkgkmvfrkedhqalqsmyhfkvkvdpavawavleeg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nndC (C:)
    dlkialiygktgpleayakqtetglmmgleyatkgtmtldgrkivvitkddqskpdlska
    alaeayqddgadiaigtsssaaaladlpvaeenkkilivepanryifrtgrnssqdaisn
    avaigkqgvtiatlaqdafgrdgvaafkealaktgatlateeyvpttdftavgqrlfdal
    kdkpgkkiiwvipltklqdmdpkrygielstggnilpalaaygmegatyyyydipknpin
    ewlvtehqkrfnappdfftaggfsaamavvtavqkakstdtekliaamegmefdtpkgkm
    vfrkedhqalqsmyhfkvkvdpavawavl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nndD (D:)
    msladdlkialiygktgpleayakqtetglmmgleyatkgtmtldgrkivvitkddqskp
    dlskaalaeayqddgadiaigtsssaaaladlpvaeenkkilivepavadqitgekwnry
    ifrtgrnssqdaisnavaigkqgvtiatlaqdyafgrdgvaafkealaktgatlateeyv
    pttttdftavgqrlfdalkdkpgkkiiwviwagggdpltklqdmdpkrygielstggnil
    palaaykrlpgmegatyyyydipknpinewlvtehqkrfnappdfftaggfsaamavvta
    vqkakstdtekliaamegmefdtpkgkmvfrkedhqalqsmyhfkvkvdpavawavleeg
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nndD (D:)
    dlkialiygktgpleayakqtetglmmgleyatkgtmtldgrkivvitkddqskpdlska
    alaeayqddgadiaigtsssaaaladlpvaeenkkilivepanryifrtgrnssqdaisn
    avaigkqgvtiatlaqdyafgrdgvaafkealaktgatlateeyvpttavgqrlfdalkd
    kpgkkiiwviwpltklqdmdpkrygielstggnilpalaaykmegatyyyydipknpine
    wlvtehqkrfnappdfftaggfsaamavvtavqkakstdtekliaamegmefdtpkgkmv
    frkedhqalqsmyhfkvkvdpavawavl