PDB entry 3nnb

View 3nnb on RCSB PDB site
Description: crystal structure of an alginate lyase (bacova_01668) from bacteroides ovatus at 1.60 a resolution
Deposited on 2010-06-23, released 2010-10-06
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alginate lyase
    Species: Bacteroides ovatus [TaxId:411476]
    Gene: BACOVA_01668
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, CIT, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nnbA (A:)
    gqvantriyaaeklakvkekadsplyapavktllrdadkalkmtppsvmdktmtadsgdk
    hdymsmgpywwpdpskpdglpyirkdgqrnpeldkldrnklgdmskavttlglayyfsgd
    ekyaqkavdflnvwfldaktkmnphltygqtipgknkgmgrgagmidiysftemidamtl
    menskaftpkvkkgmkewftqlvewmqtspvaaeeqraknnhglaydvqltayalytgnq
    dlamktiqefpekrlfaqiepdgkqplelarttalgytifnlghmldmcsiastlgqdiy
    natsqdgrsitaalkflipyigkpqsewpyqqikewdkkqeeacwilrrasffdpkagye
    aigaqfretpankrihliysle
    

    Sequence, based on observed residues (ATOM records):
    >3nnbA (A:)
    qvantriyaaeklakvkekadsplyapavktllrdadkalkmtppsvmdktmtadsgdkh
    dymsmgpywwpdpskpdglpyirkdgqrnpeldkldrnklgdmskavttlglayyfsgde
    kyaqkavdflnvwfldaktkmnphltygqtipgknkgmgrgagmidiysftemidamtlm
    enskaftpkvkkgmkewftqlvewmqtspvaaeeqraknnhglaydvqltayalytgnqd
    lamktiqefpekrlfaqiepdgkqplelarttalgytifnlghmldmcsiastlgqdiyn
    atsqdgrsitaalkflipyigkpqsewpyqqikewdkkqeeacwilrrasffdpkagyea
    igaqfretpankrihliysle