PDB entry 3nna

View 3nna on RCSB PDB site
Description: crystal structure of cugbp1 rrm1/2-rna complex
Deposited on 2010-06-23, released 2010-10-27
The last revision was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CUGBP Elav-like family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BRUNOL2, CELF1, CUGBP, CUGBP1, NAB50
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92879 (1-174)
      • expression tag (0)
  • Chain 'B':
    Compound: RNA (5'-r(*gp*up*up*gp*up*up*up*up*gp*up*up*u)-3')
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nnaA (A:)
    sdaikmfvgqvprtwsekdlrelfeqygavyeinvlrdrsqnppqskgccfvtfytrkaa
    leaqnalhnmkvlpgmhhpiqmkpadseknnavedrklfigmiskkctendirvmfssfg
    qieecrilrgpdglsrgcafvtfttramaqtaikamhqaqtmegcsspmvvkfad
    

  • Chain 'B':
    No sequence available.