PDB entry 3nn8

View 3nn8 on RCSB PDB site
Description: Crystal structure of engineered antibody fragment based on 3D5
Class: immune system
Keywords: beta barrel, antibody fragment, immunoglobulin, IMMUNE SYSTEM
Deposited on 2010-06-23, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.186
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Engineered scFv, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NN8 (0-End)
    Domains in SCOPe 2.07: d3nn8a1, d3nn8a2
  • Chain 'B':
    Compound: Engineered scFv, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NN8 (Start-115)
    Domains in SCOPe 2.07: d3nn8b_
  • Chain 'C':
    Compound: Engineered scFv, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NN8 (0-121)
    Domains in SCOPe 2.07: d3nn8c1, d3nn8c2
  • Chain 'D':
    Compound: Engineered scFv, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NN8 (0-End)
    Domains in SCOPe 2.07: d3nn8d1, d3nn8d2
  • Chain 'E':
    Compound: Engineered scFv, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NN8 (Start-115)
    Domains in SCOPe 2.07: d3nn8e_
  • Chain 'F':
    Compound: Engineered scFv, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NN8 (0-115)
    Domains in SCOPe 2.07: d3nn8f_
  • Chain 'G':
    Compound: Engineered scFv, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NN8 (0-End)
    Domains in SCOPe 2.07: d3nn8g1, d3nn8g2
  • Chain 'H':
    Compound: Engineered scFv, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NN8 (0-115)
    Domains in SCOPe 2.07: d3nn8h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nn8A (A:)
    qvqlqqsgpedvkpgasvkisckasgyslstsgmgvnwvkqspgkglewlahiywdddkr
    ynpslksratltvdktsstvylelrsltsedssvyycarrggsshyyamdywgqgttvtv
    ss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nn8A (A:)
    qvqlqqsgpedvkpgasvkisckasgyslstsgmgvnwvkqspgkglewlahiywdddkr
    ynpslksratltvdktsstvylelrsltsedssvyycarrggsshyyamdywgqgttvtv
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nn8B (B:)
    kdivmtqtpsslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnr
    fsgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgslvpptfgagtklelkrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nn8B (B:)
    divmtqtpsslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgslvpptfgagtklelkrgg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nn8C (C:)
    qvqlqqsgpedvkpgasvkisckasgyslstsgmgvnwvkqspgkglewlahiywdddkr
    ynpslksratltvdktsstvylelrsltsedssvyycarrggsshyyamdywgqgttvtv
    ss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nn8D (D:)
    qvqlqqsgpedvkpgasvkisckasgyslstsgmgvnwvkqspgkglewlahiywdddkr
    ynpslksratltvdktsstvylelrsltsedssvyycarrggsshyyamdywgqgttvtv
    ss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nn8D (D:)
    qvqlqqsgpedvkpgasvkisckasgyslstsgmgvnwvkqspgkglewlahiywdddkr
    ynpslksratltvdktsstvylelrsltsedssvyycarrggsshyyamdywgqgttvtv
    s
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nn8E (E:)
    kdivmtqtpsslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnr
    fsgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgslvpptfgagtklelkrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nn8E (E:)
    divmtqtpsslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgslvpptfgagtklelkrgg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nn8F (F:)
    kdivmtqtpsslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnr
    fsgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgslvpptfgagtklelkrgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3nn8G (G:)
    qvqlqqsgpedvkpgasvkisckasgyslstsgmgvnwvkqspgkglewlahiywdddkr
    ynpslksratltvdktsstvylelrsltsedssvyycarrggsshyyamdywgqgttvtv
    ss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nn8G (G:)
    qvqlqqsgpedvkpgasvkisckasgyslstsgmgvnwvkqspgkglewlahiywdddkr
    ynpslksratltvdktsstvylelrsltsedssvyycarrggsshyyamdywgqgttvtv
    s
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nn8H (H:)
    kdivmtqtpsslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnr
    fsgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgslvpptfgagtklelkrgg