PDB entry 3nn3

View 3nn3 on RCSB PDB site
Description: Structure of chlorite dismutase from Candidatus Nitrospira defluvii R173A mutant
Deposited on 2010-06-23, released 2010-07-28
The last revision was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.214
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chlorite dismutase
    Species: Candidatus Nitrospira defluvii [TaxId:330214]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3U4H7 (3-240)
      • engineered mutation (175)
  • Chain 'B':
    Compound: chlorite dismutase
    Species: Candidatus Nitrospira defluvii [TaxId:330214]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3U4H7 (3-240)
      • engineered mutation (175)
  • Chain 'C':
    Compound: chlorite dismutase
    Species: Candidatus Nitrospira defluvii [TaxId:330214]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3U4H7 (3-240)
      • engineered mutation (175)
  • Chain 'D':
    Compound: chlorite dismutase
    Species: Candidatus Nitrospira defluvii [TaxId:330214]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3U4H7 (3-240)
      • engineered mutation (175)
  • Chain 'E':
    Compound: chlorite dismutase
    Species: Candidatus Nitrospira defluvii [TaxId:330214]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3U4H7 (3-240)
      • engineered mutation (175)
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nn3A (A:)
    gamadreklltesgvygtfatfqmdhdwwdlpgesrvisvaevkglveqwsgkilvesyl
    lrglsdhadlmfrvhartlsdtqqflsafmgtrlgrhltsggllhgvskkptyvagfpes
    mktelqvngesgsrpyaivipikkdaewwaldqeartalmqehtqaalpylktvkaklyh
    stglddvdfityfeterledfhnlvralqqvkefrhnrrfghptllgtmspldeilekfa
    q
    

    Sequence, based on observed residues (ATOM records):
    >3nn3A (A:)
    adreklltesgvygtfatfqmdhdwwdlpgesrvisvaevkglveqwsgkilvesyllrg
    lsdhadlmfrvhartlsdtqqflsafmgtrlgrhltsggllhgvskkptyvagfpesmkt
    elqvngesgsrpyaivipikkdaewwaldqeartalmqehtqaalpylktvkaklyhstg
    lddvdfityfeterledfhnlvralqqvkefrhnrrfghptllgtmspldeilekfaq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nn3B (B:)
    gamadreklltesgvygtfatfqmdhdwwdlpgesrvisvaevkglveqwsgkilvesyl
    lrglsdhadlmfrvhartlsdtqqflsafmgtrlgrhltsggllhgvskkptyvagfpes
    mktelqvngesgsrpyaivipikkdaewwaldqeartalmqehtqaalpylktvkaklyh
    stglddvdfityfeterledfhnlvralqqvkefrhnrrfghptllgtmspldeilekfa
    q
    

    Sequence, based on observed residues (ATOM records):
    >3nn3B (B:)
    adreklltesgvygtfatfqmdhdwwdlpgesrvisvaevkglveqwsgkilvesyllrg
    lsdhadlmfrvhartlsdtqqflsafmgtrlgrhltsggllhgvskkptyvagfpesmkt
    elqvngesgsrpyaivipikkdaewwaldqeartalmqehtqaalpylktvkaklyhstg
    lddvdfityfeterledfhnlvralqqvkefrhnrrfghptllgtmspldeilekfaq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nn3C (C:)
    gamadreklltesgvygtfatfqmdhdwwdlpgesrvisvaevkglveqwsgkilvesyl
    lrglsdhadlmfrvhartlsdtqqflsafmgtrlgrhltsggllhgvskkptyvagfpes
    mktelqvngesgsrpyaivipikkdaewwaldqeartalmqehtqaalpylktvkaklyh
    stglddvdfityfeterledfhnlvralqqvkefrhnrrfghptllgtmspldeilekfa
    q
    

    Sequence, based on observed residues (ATOM records):
    >3nn3C (C:)
    adreklltesgvygtfatfqmdhdwwdlpgesrvisvaevkglveqwsgkilvesyllrg
    lsdhadlmfrvhartlsdtqqflsafmgtrlgrhltsggllhgvskkptyvagfpesmkt
    elqvngesgsrpyaivipikkdaewwaldqeartalmqehtqaalpylktvkaklyhstg
    lddvdfityfeterledfhnlvralqqvkefrhnrrfghptllgtmspldeilekfaq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nn3D (D:)
    gamadreklltesgvygtfatfqmdhdwwdlpgesrvisvaevkglveqwsgkilvesyl
    lrglsdhadlmfrvhartlsdtqqflsafmgtrlgrhltsggllhgvskkptyvagfpes
    mktelqvngesgsrpyaivipikkdaewwaldqeartalmqehtqaalpylktvkaklyh
    stglddvdfityfeterledfhnlvralqqvkefrhnrrfghptllgtmspldeilekfa
    q
    

    Sequence, based on observed residues (ATOM records):
    >3nn3D (D:)
    adreklltesgvygtfatfqmdhdwwdlpgesrvisvaevkglveqwsgkilvesyllrg
    lsdhadlmfrvhartlsdtqqflsafmgtrlgrhltsggllhgvskkptyvagfpesmkt
    elqvngesgsrpyaivipikkdaewwaldqeartalmqehtqaalpylktvkaklyhstg
    lddvdfityfeterledfhnlvralqqvkefrhnrrfghptllgtmspldeilekfaq
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nn3E (E:)
    gamadreklltesgvygtfatfqmdhdwwdlpgesrvisvaevkglveqwsgkilvesyl
    lrglsdhadlmfrvhartlsdtqqflsafmgtrlgrhltsggllhgvskkptyvagfpes
    mktelqvngesgsrpyaivipikkdaewwaldqeartalmqehtqaalpylktvkaklyh
    stglddvdfityfeterledfhnlvralqqvkefrhnrrfghptllgtmspldeilekfa
    q
    

    Sequence, based on observed residues (ATOM records):
    >3nn3E (E:)
    adreklltesgvygtfatfqmdhdwwdlpgesrvisvaevkglveqwsgkilvesyllrg
    lsdhadlmfrvhartlsdtqqflsafmgtrlgrhltsggllhgvskkptyvagfpesmkt
    elqvngesgsrpyaivipikkdaewwaldqeartalmqehtqaalpylktvkaklyhstg
    lddvdfityfeterledfhnlvralqqvkefrhnrrfghptllgtmspldeilekfaq