PDB entry 3nn0

View 3nn0 on RCSB PDB site
Description: complex of 6-hydroxy-l-nicotine oxidase with nicotinamide
Deposited on 2010-06-23, released 2011-06-15
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: 6-hydroxy-L-nicotine oxidase
    Species: ARTHROBACTER NICOTINOVORANS [TaxId:29320]
    Gene: 6-HLNO
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NCA, FAD, GP7, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'X':
    Sequence, based on SEQRES records:
    >3nn0X (X:)
    mydaivvgggfsglkaardltnagkkvllleggerlggraysresrnvpglrveiggayl
    hrkhhprlaaeldrygiptaaaseftsfrhrlgptavdqafpipgseavaveaatytllr
    dahridlekglenqdledldiplneyvdkldlppvsrqfllawawnmlgqpadqasalwm
    lqlvaahhysilgvvlsldevfsngsadlvdamsqeipeirlqtvvtgidqsgdvvnvtv
    kdghafqahsvivatpmntwrrivftpalperrrsvieeghggqglkilihvrgaeagie
    cvgdgifptlydycevseserllvaftdsgsfdptdigavkdavlyylpevevlgidyhd
    wiadplfegpwvaprvgqfsrvhkelgepagrihfvgsdvslefpgyiegaletaecavn
    ailhshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nn0X (X:)
    mydaivvgggfsglkaardltnagkkvllleggerlggraysresrnvpglrveiggayl
    hrkhhprlaaeldrygiptaaaseftsfrhrlgptavdqafpipgseavaveaatytllr
    dahridlekglenqdledldiplneyvdkldlppvsrqfllawawnmlgqpadqasalwm
    lqlvaahhysilgvvlsldevfsngsadlvdamsqeipeirlqtvvtgidqsgdvvnvtv
    kdghafqahsvivatpmntwrrivftpalperrrsvieeghggqglkilihvrgaeagie
    cvgdgifptlydycevseserllvaftdsgsfdptdigavkdavlyylpevevlgidyhd
    wiadplfegpwvaprvgqfsrvhkelgepagrihfvgsdvslefpgyiegaletaecavn
    ailhs