PDB entry 3nmy

View 3nmy on RCSB PDB site
Description: Native structure of XoMetC at pH 9.0
Class: lyase
Keywords: XometC, Cys-Met Metabolism PLP-Dependent Enzyme family, Cystathionine gamma lyase, Pyridoxal-phosphate, LYASE
Deposited on 2010-06-23, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.185
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nmya_
  • Chain 'B':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nmyb_
  • Chain 'C':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nmyc_
  • Chain 'D':
    Compound: Cystathionine gamma-lyase-like protein
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nmyd_
  • Heterogens: PLP, BCT, BME, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nmyA (A:)
    gshmsnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfe
    ysrthnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfr
    lfervrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviark
    hglltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaf
    lqnsiggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashp
    qhvlakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthas
    ipvarreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nmyA (A:)
    alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv
    aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf
    vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml
    qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl
    alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv
    sivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalv
    rlsvgiedlgdlrgdleralv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nmyB (B:)
    gshmsnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfe
    ysrthnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfr
    lfervrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviark
    hglltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaf
    lqnsiggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashp
    qhvlakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthas
    ipvarreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nmyB (B:)
    alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv
    aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf
    vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml
    qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl
    alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv
    sivlkggfdaakrfcektelftlaeslggveslvnhpavmthasipvarreqlgisdalv
    rlsvgiedlgdlrgdleralv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nmyC (C:)
    gshmsnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfe
    ysrthnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfr
    lfervrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviark
    hglltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaf
    lqnsiggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashp
    qhvlakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthas
    ipvarreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nmyC (C:)
    alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv
    aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf
    vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml
    qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl
    alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv
    sivlkggfdaakrfcektelftlaeslggveslvnhpavmthpvarreqlgisdalvrls
    vgiedlgdlrgdleralv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nmyD (D:)
    gshmsnrtthshdgdralslatlaihggqspdpstgavmppiyatstyaqsspgehqgfe
    ysrthnptrfayercvaaleggtrafafasgmaatstvmelldagshvvamddlyggtfr
    lfervrrrtagldfsfvdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviark
    hglltvvdntfaspmlqrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaf
    lqnsiggvqgpfdsflalrglktlplrmrahcenalalaqwlethpaiekviypglashp
    qhvlakrqmsgfggivsivlkggfdaakrfcektelftlaeslggveslvnhpavmthas
    ipvarreqlgisdalvrlsvgiedlgdlrgdleralvnqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nmyD (D:)
    alslatlaihggqspdpstgavmppiyatstyaqsspgehqgfeysrthnptrfayercv
    aaleggtrafafasgmaatstvmelldagshvvamddlyggtfrlfervrrrtagldfsf
    vdltdpaafkaairadtkmvwietptnpmlklvdiaaiaviarkhglltvvdntfaspml
    qrplslgadlvvhsatkylnghsdmvggiavvgdnaelaeqmaflqnsiggvqgpfdsfl
    alrglktlplrmrahcenalalaqwlethpaiekviypglashpqhvlakrqmsgfggiv
    sivlkggfdaakrfcektelftlaeslggveslvnhpavmthapvarreqlgisdalvrl
    svgiedlgdlrgdleral