PDB entry 3nmx

View 3nmx on RCSB PDB site
Description: crystal structure of apc complexed with asef
Deposited on 2010-06-22, released 2011-07-06
The last revision was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: APC variant protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4LE70 (9-End)
      • expression tag (5-8)
  • Chain 'B':
    Compound: APC variant protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4LE70 (9-End)
      • expression tag (5-8)
  • Chain 'C':
    Compound: APC variant protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4LE70 (9-End)
      • expression tag (5-8)
  • Chain 'D':
    Compound: Rho guanine nucleotide exchange factor 4
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Rho guanine nucleotide exchange factor 4
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Rho guanine nucleotide exchange factor 4
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nmxA (A:)
    mghhhhhhmlhlleqiraycetcwewqeahepgmdqdknpmpapvehqicpavcvlmkls
    fdeehrhamnelgglqaiaellqvdcemygltndhysitlrryagmaltnltfgdvanka
    tlcsmkgcmralvaqlksesedlqqviasvlrnlswradvnskktlrevgsvkalmecal
    evkkestlksvlsalwnlsahctenkadicavdgalaflvgtltyrsqtntlaiiesggg
    ilrnvssliatnedhrqilrennclqtllqhlkshsltivsnacgtlwnlsarnpkdqea
    lwdmgavsmlknlihskhkmiamgsaaalrnlmanrpakykdanimspgsslps
    

    Sequence, based on observed residues (ATOM records):
    >3nmxA (A:)
    hhhmlhlleqiraycetcwewqeahnpmpapvehqicpavcvlmklsfdeehrhamnelg
    glqaiaellqvdcemygltndhysitlrryagmaltnltfgdvankatlcsmkgcmralv
    aqlksesedlqqviasvlrnlswradvnskktlrevgsvkalmecalevkkestlksvls
    alwnlsahctenkadicavdgalaflvgtltyrsqtntlaiiesgggilrnvssliatne
    dhrqilrennclqtllqhlkshsltivsnacgtlwnlsarnpkdqealwdmgavsmlknl
    ihskhkmiamgsaaalrnlmanrpak
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nmxB (B:)
    mghhhhhhmlhlleqiraycetcwewqeahepgmdqdknpmpapvehqicpavcvlmkls
    fdeehrhamnelgglqaiaellqvdcemygltndhysitlrryagmaltnltfgdvanka
    tlcsmkgcmralvaqlksesedlqqviasvlrnlswradvnskktlrevgsvkalmecal
    evkkestlksvlsalwnlsahctenkadicavdgalaflvgtltyrsqtntlaiiesggg
    ilrnvssliatnedhrqilrennclqtllqhlkshsltivsnacgtlwnlsarnpkdqea
    lwdmgavsmlknlihskhkmiamgsaaalrnlmanrpakykdanimspgsslps
    

    Sequence, based on observed residues (ATOM records):
    >3nmxB (B:)
    hhhmlhlleqiraycetcwewqeapmpapvehqicpavcvlmklsfdeehrhamnelggl
    qaiaellqvdcemygltndhysitlrryagmaltnltfgdvankatlcsmkgcmralvaq
    lksesedlqqviasvlrnlswradvnskktlrevgsvkalmecalevkkestlksvlsal
    wnlsahctenkadicavdgalaflvgtltyrsqtntlaiiesgggilrnvssliatnedh
    rqilrennclqtllqhlkshsltivsnacgtlwnlsarnpkdqealwdmgavsmlknlih
    skhkmiamgsaaalrnlmanrpaky
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nmxC (C:)
    mghhhhhhmlhlleqiraycetcwewqeahepgmdqdknpmpapvehqicpavcvlmkls
    fdeehrhamnelgglqaiaellqvdcemygltndhysitlrryagmaltnltfgdvanka
    tlcsmkgcmralvaqlksesedlqqviasvlrnlswradvnskktlrevgsvkalmecal
    evkkestlksvlsalwnlsahctenkadicavdgalaflvgtltyrsqtntlaiiesggg
    ilrnvssliatnedhrqilrennclqtllqhlkshsltivsnacgtlwnlsarnpkdqea
    lwdmgavsmlknlihskhkmiamgsaaalrnlmanrpakykdanimspgsslps
    

    Sequence, based on observed residues (ATOM records):
    >3nmxC (C:)
    hhhmlhlleqiraycetcwewqeahapvehqicpavcvlmklsfdeehrhamnelgglqa
    iaellqvdcemygltndhysitlrryagmaltnltfgdvankatlcsmkgcmralvaqlk
    sesedlqqviasvlrnlswradvnskktlrevgsvkalmecalevkkestlksvlsalwn
    lsahctenkadicavdgalaflvgtltyrsqtntlaiiesgggilrnvssliatnedhrq
    ilrennclqtllqhlkshsltivsnacgtlwnlsarnpkdqealwdmgavsmlknlihsk
    hkmiamgsaaalrnlmanrpaky
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nmxD (D:)
    ssshhyshpggggeqlainelisdg
    

    Sequence, based on observed residues (ATOM records):
    >3nmxD (D:)
    gggeqlainelis
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nmxE (E:)
    ssshhyshpggggeqlainelisdg
    

    Sequence, based on observed residues (ATOM records):
    >3nmxE (E:)
    gggeqlainelis
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3nmxF (F:)
    ssshhyshpggggeqlainelisdg
    

    Sequence, based on observed residues (ATOM records):
    >3nmxF (F:)
    gggeqlainelis