PDB entry 3nmw

View 3nmw on RCSB PDB site
Description: crystal structure of armadillo repeats domain of apc
Deposited on 2010-06-22, released 2011-07-06
The last revision was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: APC variant protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APC variant protein
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4LE70 (9-End)
      • expression tag (5-8)
  • Chain 'B':
    Compound: APC variant protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APC variant protein
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4LE70 (9-End)
      • expression tag (5-8)
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nmwA (A:)
    mghhhhhhmlhlleqiraycetcwewqeahepgmdqdknpmpapvehqicpavcvlmkls
    fdeehrhamnelgglqaiaellqvdcemygltndhysitlrryagmaltnltfgdvanka
    tlcsmkgcmralvaqlksesedlqqviasvlrnlswradvnskktlrevgsvkalmecal
    evkkestlksvlsalwnlsahctenkadicavdgalaflvgtltyrsqtntlaiiesggg
    ilrnvssliatnedhrqilrennclqtllqhlkshsltivsnacgtlwnlsarnpkdqea
    lwdmgavsmlknlihskhkmiamgsaaalrnlmanrpakykdanimspgsslps
    

    Sequence, based on observed residues (ATOM records):
    >3nmwA (A:)
    hhhmlhlleqiraycetcwewqeahedknpmpapvehqicpavcvlmklsfdeehrhamn
    elgglqaiaellqvdcemygltndhysitlrryagmaltnltfgdvankatlcsmkgcmr
    alvaqlksesedlqqviasvlrnlswradvnskktlrevgsvkalmecalevkkestlks
    vlsalwnlsahctenkadicavdgalaflvgtltyrsqtntlaiiesgggilrnvsslia
    tnedhrqilrennclqtllqhlkshsltivsnacgtlwnlsarnpkdqealwdmgavsml
    knlihskhkmiamgsaaalrnlmanrpakyk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nmwB (B:)
    mghhhhhhmlhlleqiraycetcwewqeahepgmdqdknpmpapvehqicpavcvlmkls
    fdeehrhamnelgglqaiaellqvdcemygltndhysitlrryagmaltnltfgdvanka
    tlcsmkgcmralvaqlksesedlqqviasvlrnlswradvnskktlrevgsvkalmecal
    evkkestlksvlsalwnlsahctenkadicavdgalaflvgtltyrsqtntlaiiesggg
    ilrnvssliatnedhrqilrennclqtllqhlkshsltivsnacgtlwnlsarnpkdqea
    lwdmgavsmlknlihskhkmiamgsaaalrnlmanrpakykdanimspgsslps
    

    Sequence, based on observed residues (ATOM records):
    >3nmwB (B:)
    hhhmlhlleqiraycetcwewqeahedknpmpapvehqicpavcvlmklsfdeehrhamn
    elgglqaiaellqvdcemygltndhysitlrryagmaltnltfgdvankatlcsmkgcmr
    alvaqlksesedlqqviasvlrnlswradvnskktlrevgsvkalmecalevkkestlks
    vlsalwnlsahctenkadicavdgalaflvgtltyrsqtntlaiiesgggilrnvsslia
    tnedhrqilrennclqtllqhlkshsltivsnacgtlwnlsarnpkdqealwdmgavsml
    knlihskhkmiamgsaaalrnlmanrpakyk