PDB entry 3nmu

View 3nmu on RCSB PDB site
Description: Crystal Structure of substrate-bound halfmer box C/D RNP
Class: Transferase/RNA
Keywords: Kink-turn motif, RNA assembly motif, Transferase-RNA complex
Deposited on 2010-06-22, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: 0.224
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NOP5/NOP56 related protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF0060
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: NOP5/NOP56 related protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF0060
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 50S ribosomal protein L7Ae
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rpl7ae, PF1367
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: RNA (34-mer)
    Species: Pyrococcus furiosus [TaxId:2261]
  • Chain 'E':
    Compound: RNA (34-mer)
    Species: Pyrococcus furiosus [TaxId:2261]
  • Chain 'F':
    Compound: Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: flpA, PF0059
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nmuf_
  • Chain 'G':
    Compound: 50S ribosomal protein L7Ae
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: rpl7ae, PF1367
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: RNA (5'-r(*gp*ap*gp*cp*up*up*cp*ap*ap*cp*gp*gp*c)-3')
    Species: synthetic, synthetic [TaxId:32630]
  • Chain 'J':
    Compound: Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: flpA, PF0059
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nmuj_
  • Chain 'K':
    Compound: RNA (5'-r(*gp*ap*gp*cp*up*up*cp*ap*ap*cp*gp*gp*c)-3')
    Species: synthetic, synthetic [TaxId:32630]
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nmuF (F:)
    mhhhhhhmvevkkhkfpgvyvvidddgsekiatknlvpgqrvygervikwegeeyriwnp
    hrsklgaaivnglknfpikpgksvlylgiasgttashvsdivgwegkiygiefsprvlre
    lvpiveerrniipilgdatkpeeyralvtkvdvifedvaqptqakilidnakaylkrggy
    gmiavksrsidvtkepeqvfkeverelseyfevierlnlepyekdhalfvvrkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nmuF (F:)
    mvevkkhkfpgvyvvidddgsekiatknlvpgqrvygervikwegeeyriwnphrsklga
    aivnglknfpikpgksvlylgiasgttashvsdivgwegkiygiefsprvlrelvpivee
    rrniipilgdatkpeeyralvtkvdvifedvaqptqakilidnakaylkrggygmiavks
    rsidvtkepeqvfkeverelseyfevierlnlepyekdhalfvvrkp
    

  • Chain 'G':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3nmuJ (J:)
    mhhhhhhmvevkkhkfpgvyvvidddgsekiatknlvpgqrvygervikwegeeyriwnp
    hrsklgaaivnglknfpikpgksvlylgiasgttashvsdivgwegkiygiefsprvlre
    lvpiveerrniipilgdatkpeeyralvtkvdvifedvaqptqakilidnakaylkrggy
    gmiavksrsidvtkepeqvfkeverelseyfevierlnlepyekdhalfvvrkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nmuJ (J:)
    mvevkkhkfpgvyvvidddgsekiatknlvpgqrvygervikwegeeyriwnphrsklga
    aivnglknfpikpgksvlylgiasgttashvsdivgwegkiygiefsprvlrelvpivee
    rrniipilgdatkpeeyralvtkvdvifedvaqptqakilidnakaylkrggygmiavks
    rsidvtkepeqvfkeverelseyfevierlnlepyekdhalfvvrkp
    

  • Chain 'K':
    No sequence available.