PDB entry 3nms

View 3nms on RCSB PDB site
Description: staphylococcal complement inhibitor (scin) in complex with human complement c3c
Deposited on 2010-06-22, released 2010-08-04
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 4.1 Å
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Complement C3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Complement C3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: staphylococcal complement inhibitor
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: SAV1942, scn
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nmsA (A:)
    spmysiitpnilrleseetmvleahdaqgdvpvtvtvhdfpgkklvlssektvltpatnh
    mgnvtftipanrefksekgrnkfvtvqatfgtqvvekvvlvslqsgylfiqtdktiytpg
    stvlyriftvnhkllpvgrtvmvnienpegipvkqdslssqnqlgvlplswdipelvnmg
    qwkirayyenspqqvfstefevkeyvlpsfeviveptekfyyiynekglevtitarflyg
    kkvegtafvifgiqdgeqrislpeslkripiedgsgevvlsrkvlldgvqnpraedlvgk
    slyvsatvilhsgsdmvqaersgipivtspyqihftktpkyfkpgmpfdlmvfvtnpdgs
    payrvpvavqgedtvqsltqgdgvaklsinthpsqkplsitvrtkkqelseaeqatrtmq
    alpystvgnsnnylhlsvlrtelrpgetlnvnfllrmdraheakiryytylimnkgrllk
    agrqvrepgqdlvvlplsittdfipsfrlvayytligasgqrevvadsvwvdvkdscvgs
    lvvksgqsedrqpvpgqqmtlkiegdhgarvvlvavdkgvfvlnkknkltqskiwdvvek
    adigctpgsgkdyagvfsdagltftsssgqqtaqraelqcpqpaa
    

    Sequence, based on observed residues (ATOM records):
    >3nmsA (A:)
    spmysiitpnilrleseetmvleahdaqgdvpvtvtvhdfpgkklvlssektvltpatnh
    mgnvtftipanrekgrnkfvtvqatfgtqvvekvvlvslqsgylfiqtdktiytpgstvl
    yriftvnhkllpvgrtvmvnienpegipvkqdslssqnqlgvlplswdipelvnmgqwki
    rayyenspqqvfstefevkeyvlpsfeviveptekfyyiynekglevtitarflygkkve
    gtafvifgiqdgeqrislpeslkripiedgsgevvlsrkvlldgvqnpraedlvgkslyv
    satvilhsgsdmvqaersgipivtspyqihftktpkyfkpgmpfdlmvfvtnpdgspayr
    vpvavqgedtvqsltqgdgvaklsinthpsqkplsitvrtkkqelseaeqatrtmqalpy
    stvgnsnnylhlsvlrtelrpgetlnvnfllrmdraheakiryytylimnkgrllkagrq
    vrepgqdlvvlplsittdfipsfrlvayytligasgqrevvadsvwvdvkdscvgslvvk
    sgqsedrqpvpgqqmtlkiegdhgarvvlvavdkgvfvlnkknkltqskiwdvvekadig
    ctpgsgkdyagvfsdagltftsssgqqtaqraelqcpqpaa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nmsB (B:)
    snldediiaeenivsrsefpeswlwnvedlkeppkngistklmniflkdsittweilavs
    msdkkgicvadpfevtvmqdffidlrlpysvvrneqveiravlynyrqnqelkvrvellh
    npafcslattkrrhqqtvtippksslsvpyvivplktglqevevkaavyhhfisdgvrks
    lkvvpegirmnktvavrtldperlgr
    

    Sequence, based on observed residues (ATOM records):
    >3nmsB (B:)
    ldediiaeenivsrsefpeswlwnvedlkeppkngistklmniflkdsittweilavsms
    dkkgicvadpfevtvmqdffidlrlpysvvrneqveiravlynyrqnqelkvrvellhnp
    afcslattkrrhqqtvtippksslsvpyvivplktglqevevkaavyhhfisdgvrkslk
    vvpe
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nmsC (C:)
    seetkenegftvtaegkgqgtlsvvtmyhakakdqltcnkfdlkvtikpapetekrpqda
    kntmileictryrgdqdatmsildismmtgfapdtddlkqlangvdryiskyeldkafsd
    rntliiyldkvshseddclafkvhqyfnveliqpgavkvyayynleesctrfyhpekedg
    klnklcrdelcrcaeencfiqksddkvtleerldkacepgvdyvyktrlvkvqlsndfde
    yimaieqtiksgsdevqvgqqrtfispikcrealkleekkhylmwglssdfwgekpnlsy
    iigkdtwvehwpeedecqdeenqkqcqdlgaftesmvvfgcpn
    

    Sequence, based on observed residues (ATOM records):
    >3nmsC (C:)
    cnkfdlkvtikpapeakntmileictryrgdqdatmsildismmtgfapdtddlkqlang
    vdryiskyeldkafsdrntliiyldkvshseddclafkvhqyfnveliqpgavkvyayyn
    leesctrfyhpekedgklnklcrdelcrcaeencfikvtleerldkacepgvdyvyktrl
    vkvqlsndfdeyimaieqtiksgsdevqvgqqrtfispikcrealkleekkhylmwglss
    dfwgekpnlsyiigkdtwvehwpeedecqdeenqkqcqdlgaftesmvvfgcpn
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >3nmsM (M:)
    gtsstslptsneyqneklanelkslldelnvnelatgslntyykrtikisgqkamyalks
    kdfkkmseakyqlqkiyneidealksky
    

    Sequence, based on observed residues (ATOM records):
    >3nmsM (M:)
    tslptsneyqneklanelkslldelnvnelatgslntyykrtikisgqkamyalkskdfk
    kmseakyqlqkiyneidealksky