PDB entry 3nmq

View 3nmq on RCSB PDB site
Description: Hsp90b N-terminal domain in complex with EC44, a pyrrolo-pyrimidine methoxypyridine inhibitor
Class: chaperone/chaperone inhibitor
Keywords: ATPase, CHAPERONE-CHAPERONE INHIBITOR complex
Deposited on 2010-06-22, released 2010-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heat shock protein hsp 90-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AB1, HSP90B, HSPC2, HSPCB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nmqa_
  • Heterogens: 7PP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nmqA (A:)
    dptlmpeevhhgeeevetfafqaeiaqlmsliintfysnkeiflrelisnasdaldkiry
    esltdpskldsgkelkidiipnpqertltlvdtgigmtkadlinnlgtiaksgtkafmea
    lqagadismigqfgvgfysaylvaekvvvitkhnddeqyawessaggsftvradhgepig
    rgtkvilhlkedqteyleerrvkevvkkhsqfigypitlylekerekgefnsklgcfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nmqA (A:)
    geeevetfafqaeiaqlmsliintfysnkeiflrelisnasdaldkiryesltdpsklds
    gkelkidiipnpqertltlvdtgigmtkadlinnlgtiaksgtkafmealqagadismig
    qfgvgfysaylvaekvvvitkhnddeqyawessaggsftvradhgepigrgtkvilhlke
    dqteyleerrvkevvkkhsqfigypitlyleker