PDB entry 3nmo

View 3nmo on RCSB PDB site
Description: Crystal structure of an engineered monomeric CLC-ec1 Cl-/H+ transporter
Class: transport protein
Keywords: CLC transporter, Chloride-proton antiport, TRANSPORT PROTEIN
Deposited on 2010-06-22, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.265
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli [TaxId:216592]
    Gene: clcA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • engineered mutation (200)
      • engineered mutation (421)
    Domains in SCOPe 2.07: d3nmoa_
  • Heterogens: CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nmoA (A:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiweemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lwlpmiitglgatllaqftggkplysailartlakqeaeqlarsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nmoA (A:)
    irqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypllltv
    aflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglgtlgg
    gmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagilfiw
    eemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlylilgii
    fgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggfnlip
    iatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvavelfpq
    yhleagtfaiagmgallaasirapltgiilvlemtdnyqlwlpmiitglgatllaqftgg
    kplysailartlakqeaeq