PDB entry 3nmn

View 3nmn on RCSB PDB site
Description: Crystal structure of pyrabactin-bound abscisic acid receptor PYL1 in complex with type 2C protein phosphatase ABI1
Deposited on 2010-06-22, released 2010-08-25
The last revision was dated 2010-09-15, with a file datestamp of 2010-09-10.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.213
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Abscisic acid receptor PYL1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PYL1, RCAR12, At5g46790, MZA15.21
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VZS8 (2-End)
      • expression tag (1)
  • Chain 'B':
    Compound: Protein phosphatase 2C 56
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ABI1, At4g26080, F20B18.190
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Abscisic acid receptor PYL1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: PYL1, RCAR12, At5g46790, MZA15.21
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VZS8 (2-177)
      • expression tag (1)
  • Chain 'D':
    Compound: Protein phosphatase 2C 56
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ABI1, At4g26080, F20B18.190
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PYV, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nmnA (A:)
    gseftqlsqsiaefhtyqlgngrcssllaqrihappetvwsvvrrfdrpqiykhfikscn
    vsedfemrvgctrdvnvisglpantsrerldlldddrrvtgfsitggehrlrnyksvttv
    hrfekeeeeeriwtvvlesyvvdvpegnseedtrlfadtvirlnlqklasiteamnrn
    

    Sequence, based on observed residues (ATOM records):
    >3nmnA (A:)
    seftqlsqsiaefhtyqlgngrcssllaqrihappetvwsvvrrfdrpqiykhfikscnv
    sedfemrvgctrdvnvisglpantsrerldlldddrrvtgfsitggehrlrnyksvttvh
    rfeiwtvvlesyvvdvpegnseedtrlfadtvirlnlqklasiteamn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nmnB (B:)
    gsrslfefksvplygftsicgrrpemedavstiprflqsssgsmldgrfdpqsaahffgv
    ydghggsqvanycrermhlalaeeiakekpmlcdgdtwlekwkkalfnsflrvdseiesv
    apetvgstsvvavvfpshifvancgdsravlcrgktalplsvdhkpdredeaarieaagg
    kviqwngarvfgvlamsrsigdrylkpsiipdpevtavkrvkeddclilasdgvwdvmtd
    eeacemarkrillwhkknavagdaslladerrkegkdpaamsaaeylsklaiqrgskdni
    svvvvdlkprrklkskpln
    

    Sequence, based on observed residues (ATOM records):
    >3nmnB (B:)
    vplygftsicgrrpemedavstiprflqsdpqsaahffgvydghggsqvanycrermhla
    laeeiakekpmldgdtwlekwkkalfnsflrvdseiesvapetvgstsvvavvfpshifv
    ancgdsravlcrgktalplsvdhkpdredeaarieaaggkviqwngarvfgvlamsrsig
    drylkpsiipdpevtavkrvkeddclilasdgvwdvmtdeeacemarkrillwhkegkdp
    aamsaaeylsklaiqrgskdnisvvvvdlkp
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nmnC (C:)
    gseftqlsqsiaefhtyqlgngrcssllaqrihappetvwsvvrrfdrpqiykhfikscn
    vsedfemrvgctrdvnvisglpantsrerldlldddrrvtgfsitggehrlrnyksvttv
    hrfekeeeeeriwtvvlesyvvdvpegnseedtrlfadtvirlnlqklasiteamnrn
    

    Sequence, based on observed residues (ATOM records):
    >3nmnC (C:)
    seftqlsqsiaefhtyqlgngrcssllaqrihappetvwsvvrrfdrpqiykhfikscnv
    sedfemrvgctrdvnvisglpantsrerldlldddrrvtgfsitggehrlrnyksvttvh
    rferiwtvvlesyvvdvpegnseedtrlfadtvirlnlqklasiteamnrn
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nmnD (D:)
    gsrslfefksvplygftsicgrrpemedavstiprflqsssgsmldgrfdpqsaahffgv
    ydghggsqvanycrermhlalaeeiakekpmlcdgdtwlekwkkalfnsflrvdseiesv
    apetvgstsvvavvfpshifvancgdsravlcrgktalplsvdhkpdredeaarieaagg
    kviqwngarvfgvlamsrsigdrylkpsiipdpevtavkrvkeddclilasdgvwdvmtd
    eeacemarkrillwhkknavagdaslladerrkegkdpaamsaaeylsklaiqrgskdni
    svvvvdlkprrklkskpln
    

    Sequence, based on observed residues (ATOM records):
    >3nmnD (D:)
    svplygftsicgrrpemedavstiprflqsdpqsaahffgvydghggsqvanycrermhl
    alaeeiakekpmlcdgdtwlekwkkalfnsflrvdseiesvapetvgstsvvavvfpshi
    fvancgdsravlcrgktalplsvdhkpdredeaarieaaggkviqwngarvfgvlamsrs
    igdrylkpsiipdpevtavkrvkeddclilasdgvwdvmtdeeacemarkrillwhkkna
    egkdpaamsaaeylsklaiqrgskdnisvvvvdlkp