PDB entry 3nml

View 3nml on RCSB PDB site
Description: Sperm whale myoglobin mutant H64W carbonmonoxy-form
Class: oxygen storage
Keywords: Myoglobin, ligand migration pathways, oxygen storage
Deposited on 2010-06-22, released 2010-07-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.169
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: MB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-153)
    • engineered mutation (64)
    • variant (122)
  Domains in SCOPe 2.01: d3nmla_
• Heterogens: HEM, CMO, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3nmlA (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkwgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg