PDB entry 3nml

View 3nml on RCSB PDB site
Description: Sperm whale myoglobin mutant H64W carbonmonoxy-form
Class: oxygen storage
Keywords: Myoglobin, ligand migration pathways, oxygen storage
Deposited on 2010-06-22, released 2010-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.169
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-153)
      • engineered mutation (64)
      • variant (122)
    Domains in SCOPe 2.07: d3nmla_
  • Heterogens: HEM, CMO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nmlA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkwgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg