PDB entry 3nmk

View 3nmk on RCSB PDB site
Description: Crystal structure of a zinc mediated dimer for the phenanthroline-modified cytochrome cb562 variant, MBP-Phen2
Class: electron transport
Keywords: 4-helix-bundle, ELECTRON TRANSPORT
Deposited on 2010-06-22, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.191
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (61-62)
      • engineered mutation (65)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3nmka_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (61-62)
      • engineered mutation (65)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3nmkb_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (61-62)
      • engineered mutation (65)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3nmkc_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (61-62)
      • engineered mutation (65)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3nmkd_
  • Heterogens: HEM, PXX, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nmkA (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfailvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nmkB (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfailvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nmkC (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfailvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nmkD (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfailvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr