PDB entry 3nmi

View 3nmi on RCSB PDB site
Description: Crystal structure of the phenanthroline-modified cytochrome cb562 variant, MBP-Phen2
Class: electron transport
Keywords: 4-helix-bundle, ELECTRON TRANSPORT
Deposited on 2010-06-22, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-29, with a file datestamp of 2010-12-24.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.2
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (61-62)
      • engineered mutation (65)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3nmia_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (61-62)
      • engineered mutation (65)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3nmib_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (61-62)
      • engineered mutation (65)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3nmic_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (61-62)
      • engineered mutation (65)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3nmid_
  • Chain 'E':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (61-62)
      • engineered mutation (65)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3nmie_
  • Chain 'F':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (58)
      • engineered mutation (61-62)
      • engineered mutation (65)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d3nmif_
  • Heterogens: HEM, PXX, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nmiA (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfailvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nmiB (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfailvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nmiC (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfailvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nmiD (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfailvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nmiE (E:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfailvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nmiF (F:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemcd
    faagfailvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr