PDB entry 3nme

View 3nme on RCSB PDB site
Description: Structure of a plant phosphatase
Deposited on 2010-06-22, released 2010-08-11
The last revision was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SEX4 glucan phosphatase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g52180
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q944A8 (4-293)
      • engineered mutation (112)
  • Chain 'B':
    Compound: SEX4 glucan phosphatase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g52180
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q944A8 (4-End)
      • engineered mutation (112)
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nmeA (A:)
    gshmyrhelgmnynfirpdlivgsclqtpedvdklrkigvktifclqqdpdleyfgvdis
    siqayakkysdiqhirceirdfdafdlrmrlpavvgtlykavkrnggvtyvhstagmgra
    pavaltymfwvqgyklmeahkllmskrscfpkldairnatidiltglkrktvtltlkdkg
    fsrveisgldigwgqripltlgkgtgfwilkrelpegqfeykyiidgewthneaepfigp
    nkdghtnnyakvvddptsvdgttrerlssedpelleeerskliqfletcseaev
    

    Sequence, based on observed residues (ATOM records):
    >3nmeA (A:)
    yrhelgmnynfirpdlivgsclqtpedvdklrkigvktifclqqdpdleyfgvdissiqa
    yakkysdiqhirceirdfdafdlrmrlpavvgtlykavkrnggvtyvhstagmgrapava
    ltymfwvqgyklmeahkllmskrscfpkldairnatidiltglkrktvtltlkdkgfsrv
    eisgldigwgqripltlgkgtgfwilkrelpegqfeykyiidgewthneaepfigpnkdg
    htnnyakvvddptsvdgttrerlssedpelleeerskliqfletcseaev
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nmeB (B:)
    gshmyrhelgmnynfirpdlivgsclqtpedvdklrkigvktifclqqdpdleyfgvdis
    siqayakkysdiqhirceirdfdafdlrmrlpavvgtlykavkrnggvtyvhstagmgra
    pavaltymfwvqgyklmeahkllmskrscfpkldairnatidiltglkrktvtltlkdkg
    fsrveisgldigwgqripltlgkgtgfwilkrelpegqfeykyiidgewthneaepfigp
    nkdghtnnyakvvddptsvdgttrerlssedpelleeerskliqfletcseaev
    

    Sequence, based on observed residues (ATOM records):
    >3nmeB (B:)
    yrhelgmnynfirpdlivgsclqtpedvdklrkigvktifclqqdpdleyfgvdissiqa
    yakkysdiqhirceirdfdafdlrmrlpavvgtlykavkrnggvtyvhstagmgrapava
    ltymfwvqgyklmeahkllmskrscfpkldairnatidiltglkrktvtltlkdkgfsrv
    eisgldigwgqripltlgkgtgfwilkrelpegqfeykyiidgewthneaepfigpnkdg
    htnnyakvvddptsvdgttrerlssedpelleeerskliqfletcseae