PDB entry 3nmd

View 3nmd on RCSB PDB site
Description: Crystal structure of the leucine zipper domain of cGMP dependent protein kinase I beta
Deposited on 2010-06-22, released 2010-09-08
The last revision was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.197
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP Dependent PRotein Kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P5T7 (20-End)
      • expression tag (18-19)
      • engineered mutation (57)
  • Chain 'B':
    Compound: cGMP Dependent PRotein Kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P5T7 (20-End)
      • engineered mutation (57)
  • Chain 'C':
    Compound: cGMP Dependent PRotein Kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P5T7 (20-End)
      • expression tag (17-19)
      • engineered mutation (57)
  • Chain 'D':
    Compound: cGMP Dependent PRotein Kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P5T7 (20-End)
      • expression tag (18-19)
      • engineered mutation (57)
  • Chain 'E':
    Compound: cGMP Dependent PRotein Kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P5T7 (20-End)
      • expression tag (19)
      • engineered mutation (57)
  • Heterogens: HEZ, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nmdA (A:)
    mrgshhhhhhgmasiegrgslrdlqyalqekieelrqrdalideleleldqkdeliqmlq
    neldkyrsvirp
    

    Sequence, based on observed residues (ATOM records):
    >3nmdA (A:)
    gslrdlqyalqekieelrqrdalideleleldqkdeliqmlqneldkyrsvir
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nmdB (B:)
    mrgshhhhhhgmasiegrgslrdlqyalqekieelrqrdalideleleldqkdeliqmlq
    neldkyrsvirp
    

    Sequence, based on observed residues (ATOM records):
    >3nmdB (B:)
    lrdlqyalqekieelrqrdalideleleldqkdeliqmlqneldkyr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nmdC (C:)
    mrgshhhhhhgmasiegrgslrdlqyalqekieelrqrdalideleleldqkdeliqmlq
    neldkyrsvirp
    

    Sequence, based on observed residues (ATOM records):
    >3nmdC (C:)
    rgslrdlqyalqekieelrqrdalideleleldqkdeliqmlqneldkyrsvi
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nmdD (D:)
    mrgshhhhhhgmasiegrgslrdlqyalqekieelrqrdalideleleldqkdeliqmlq
    neldkyrsvirp
    

    Sequence, based on observed residues (ATOM records):
    >3nmdD (D:)
    gslrdlqyalqekieelrqrdalideleleldqkdeliqmlqneldkyrs
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nmdE (E:)
    mrgshhhhhhgmasiegrgslrdlqyalqekieelrqrdalideleleldqkdeliqmlq
    neldkyrsvirp
    

    Sequence, based on observed residues (ATOM records):
    >3nmdE (E:)
    slrdlqyalqekieelrqrdalideleleldqkdeliqmlqneldkyrsvi