PDB entry 3nmb

View 3nmb on RCSB PDB site
Description: Crystal structure of a putative sugar hydrolase (BACOVA_03189) from Bacteroides ovatus at 2.40 A resolution
Deposited on 2010-06-22, released 2010-08-18
The last revision was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.172
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative sugar hydrolase
    Species: Bacteroides ovatus [TaxId:411476]
    Gene: BACOVA_03189
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, PEG, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nmbA (A:)
    gqeepskvalsyskslkapetdslnlpvdengyitifdgetfngwrgygkdrvptkwtie
    dgcikfngsgggeaqdgdggdlifahkfknfelelewkvakgsnsgilylaqevtskdkd
    gndvlepiyisapeyqildnanhpdaklgkdnnrqsaslydmipavpqnskpfgewnkak
    imvykgtvvhgqndenvleyhlwtkqwtdmlqaskfsedkwplafellnncggenhegfi
    glqdhgddvwfrnirvkvld
    

    Sequence, based on observed residues (ATOM records):
    >3nmbA (A:)
    pskvalsyskslkapetdslnlpvdengyitifdgetfngwrgygkdrvptkwtiedgci
    kfngsgggeaqdgdggdlifahkfknfelelewkvakgsnsgilylaqevtskdkdgndv
    lepiyisapeyqildnanhpdaklgkdnnrqsaslydmipavpqnskpfgewnkakimvy
    kgtvvhgqndenvleyhlwtkqwtdmlqaskfsedkwplafellnncggenhegfiglqd
    hgddvwfrnirvkvld