PDB entry 3nma

View 3nma on RCSB PDB site
Description: Mutant P169S of Foot-and-mouth disease Virus RNA dependent RNA-polymerase
Class: transferase/RNA
Keywords: Foot-and-mouth disease virus, 3D polymerase RNA-dependent RNA polymerase, picornavirus, Ribavirin, TRANSFERASE-RNA complex
Deposited on 2010-06-22, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3D polymerase
    Species: Foot-and-mouth disease virus - type C [TaxId:12116]
    Gene: 3D
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QCE4 (0-469)
      • engineered mutation (168)
      • expression tag (470-475)
    Domains in SCOPe 2.07: d3nmaa1, d3nmaa2
  • Chain 'B':
    Compound: 5'-r(*gp*gp*c)-3'
  • Chain 'C':
    Compound: 5'-r(p*cp*c)-3'
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nmaA (A:)
    glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
    kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
    walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirsmekvragktri
    vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
    ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
    satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
    gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
    qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaalahh
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.