PDB entry 3nm9

View 3nm9 on RCSB PDB site
Description: HMGD(M13A)-DNA complex
Class: gene regulation/DNA
Keywords: High mobility group, DNA bending, non-sequence-specific, HMG domain, chromosomal protein, DNA, GENE REGULATION-DNA complex
Deposited on 2010-06-22, released 2010-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.248
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high mobility group protein d
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG17950, HmgD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05783 (0-72)
      • engineered mutation (11)
    Domains in SCOPe 2.07: d3nm9a_
  • Chain 'B':
    Compound: DNA 5'-d(*g*gp*cp*gp*ap*tp*ap*tp*cp*gp*c)-3'
  • Chain 'C':
    Compound: DNA 5'-d(*g*gp*cp*gp*ap*tp*ap*tp*cp*gp*c)-3'
  • Chain 'D':
    Compound: high mobility group protein d
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG17950, HmgD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05783 (0-72)
      • engineered mutation (11)
    Domains in SCOPe 2.07: d3nm9d_
  • Chain 'E':
    Compound: DNA 5'-d(*g*gp*cp*gp*ap*tp*ap*tp*cp*gp*c)-3'
  • Chain 'F':
    Compound: DNA 5'-d(*g*gp*cp*gp*ap*tp*ap*tp*cp*gp*c)-3'
  • Chain 'G':
    Compound: high mobility group protein d
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG17950, HmgD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05783 (0-72)
      • engineered mutation (11)
    Domains in SCOPe 2.07: d3nm9g_
  • Chain 'H':
    Compound: DNA 5'-d(*g*gp*cp*gp*ap*tp*ap*tp*cp*gp*c)-3'
  • Chain 'I':
    Compound: DNA 5'-d(*g*gp*cp*gp*ap*tp*ap*tp*cp*gp*c)-3'
  • Chain 'J':
    Compound: high mobility group protein d
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG17950, HmgD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05783 (0-72)
      • engineered mutation (11)
    Domains in SCOPe 2.07: d3nm9j_
  • Chain 'K':
    Compound: DNA 5'-d(*g*gp*cp*gp*ap*tp*ap*tp*cp*gp*c)-3'
  • Chain 'L':
    Compound: DNA 5'-d(*g*gp*cp*gp*ap*tp*ap*tp*cp*gp*c)-3'
  • Chain 'M':
    Compound: high mobility group protein d
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG17950, HmgD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05783 (0-72)
      • engineered mutation (11)
    Domains in SCOPe 2.07: d3nm9m_
  • Chain 'N':
    Compound: DNA 5'-d(*g*gp*cp*gp*ap*tp*ap*tp*cp*gp*c)-3'
  • Chain 'O':
    Compound: DNA 5'-d(*g*gp*cp*gp*ap*tp*ap*tp*cp*gp*c)-3'
  • Chain 'P':
    Compound: high mobility group protein d
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CG17950, HmgD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05783 (0-72)
      • engineered mutation (11)
    Domains in SCOPe 2.07: d3nm9p_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nm9A (A:)
    sdkpkrplsayalwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
    dydravkefeang
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nm9D (D:)
    sdkpkrplsayalwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
    dydravkefeang
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nm9G (G:)
    sdkpkrplsayalwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
    dydravkefeang
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nm9J (J:)
    sdkpkrplsayalwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
    dydravkefeang
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nm9M (M:)
    sdkpkrplsayalwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
    dydravkefeang
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nm9P (P:)
    sdkpkrplsayalwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
    dydravkefeang