PDB entry 3nm7

View 3nm7 on RCSB PDB site
Description: Crystal Structure of Borrelia burgdorferi Pur-alpha
Deposited on 2010-06-22, released 2010-10-06
The last revision was dated 2010-10-27, with a file datestamp of 2010-10-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: BB_0047
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: BB_0047
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: BB_0047
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Uncharacterized protein
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: BB_0047
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nm7A (A:)
    mwrklmgergevyseklftesertyffnvkenrkgdyflniveskrspsgdferhsifvy
    eeninefesnllkaiavikqkvstgsvgssarhnkgygeygersklddsrfdkkshlsgg
    rfkkkdy
    

    Sequence, based on observed residues (ATOM records):
    >3nm7A (A:)
    ergevyseklftesertyffnvkenrkgdyflniveskrspsgdferhsifvyeeninef
    esnllkaiavikqkvstgssarhn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nm7B (B:)
    mwrklmgergevyseklftesertyffnvkenrkgdyflniveskrspsgdferhsifvy
    eeninefesnllkaiavikqkvstgsvgssarhnkgygeygersklddsrfdkkshlsgg
    rfkkkdy
    

    Sequence, based on observed residues (ATOM records):
    >3nm7B (B:)
    evyseklftesertyffnvkenrkgdyflniveskrspsgdferhsifvyeeninefesn
    llkaiavikqkvst
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nm7C (C:)
    mwrklmgergevyseklftesertyffnvkenrkgdyflniveskrspsgdferhsifvy
    eeninefesnllkaiavikqkvstgsvgssarhnkgygeygersklddsrfdkkshlsgg
    rfkkkdy
    

    Sequence, based on observed residues (ATOM records):
    >3nm7C (C:)
    ergevyseklftesertyffnvkenrkgdyflniveskrspsgdferhsifvyeeninef
    esnllkaiavikqkv
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nm7D (D:)
    mwrklmgergevyseklftesertyffnvkenrkgdyflniveskrspsgdferhsifvy
    eeninefesnllkaiavikqkvstgsvgssarhnkgygeygersklddsrfdkkshlsgg
    rfkkkdy
    

    Sequence, based on observed residues (ATOM records):
    >3nm7D (D:)
    rgevyseklftesertyffnvkenrkgdyflniveskrspsgdferhsifvyeeninefe
    snllkaiavikqkvst