PDB entry 3nm6

View 3nm6 on RCSB PDB site
Description: Helicobacter pylori MTAN complexed with adenine and tris
Class: hydrolase
Keywords: nucleosidase, HYDROLASE
Deposited on 2010-06-21, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.143
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: MTA/SAH nucleosidase
    Species: Helicobacter pylori [TaxId:85963]
    Gene: jhp_0082, mtn, mtnN, Pfs
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nm6b_
  • Heterogens: ADE, TRS, EDO, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nm6B (B:)
    mqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstlt
    ttsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaif
    ietsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasva
    fvcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nm6B (B:)
    qkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstltt
    tsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaifi
    etsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasvaf
    vcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel