PDB entry 3nm2

View 3nm2 on RCSB PDB site
Description: Crystal Structure of Ketosteroid Isomerase D38EP39GV40GS42G from Pseudomonas Testosteroni (tKSI)
Class: isomerase
Keywords: Isomerase
Deposited on 2010-06-21, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Comamonas testosteroni [TaxId:285]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (0-124)
      • engineered mutation (37-39)
      • engineered mutation (41)
    Domains in SCOPe 2.07: d3nm2a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nm2A (A:)
    mntpehmtavvqryvaalnagdldgivalfaddatveeggggeprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapidhfrfngagkvvsmralfgekn
    ihaga