PDB entry 3nm1

View 3nm1 on RCSB PDB site
Description: The Crystal Structure of Candida glabrata THI6, a Bifunctional Enzyme involved in Thiamin Biosyhthesis of Eukaryotes
Deposited on 2010-06-21, released 2010-11-10
The last revision was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 3.21 Å
R-factor: 0.203
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 3NM, IFP, POP, MG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nm1A (A:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnllltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nm1A (A:)
    kfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealqi
    kelchahnvpliindridvamaigadgihvgqddmpipmirklvgmvigwsvgfpeevde
    lskmgpvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgigglhpd
    niervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvniglsslt
    ttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevndlaaipha
    tlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnllltfgqfscikg
    nsseilglaelsnelliqatkivafkyktvavctgefdfiadgtiegkyslstngtsved
    ipcvaveagpigcslgstiacmiggqpsegnlfhavvagvmlykaagkiasekcngsgsf
    qvelidalyrltrentpvtwapkltht
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nm1B (B:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnllltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nm1B (B:)
    kfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealqi
    kelchahnvpliindridvamaigadgihvgqddmpipmirklvgmvigwsvgfpeevde
    lskmgpvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgigglhpd
    niervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvniglsslt
    ttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevndlaaipha
    tlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnllltfgqfscikg
    nsseilglaelsnelliqatkivafkyktvavctgefdfiadgtiegkyslstngtsved
    ipcvaveagpigcslgstiacmiggqpsegnlfhavvagvmlykaagkiasekcngsgsf
    qvelidalyrltrentpvtwapkltht
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nm1C (C:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnllltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nm1C (C:)
    kfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealqi
    kelchahnvpliindridvamaigadgihvgqddmpipmirklvgmvigwsvgfpeevde
    lskmgpvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgigglhpd
    niervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvniglsslt
    ttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevndlaaipha
    tlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnllltfgqfscikg
    nsseilglaelsnelliqatkivafkyktvavctgefdfiadgtiegkyslstngtsved
    ipcvaveagpigcslgstiacmiggqpsegnlfhavvagvmlykaagkiasekcngsgsf
    qvelidalyrltrentpvtwapkltht
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nm1D (D:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnllltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nm1D (D:)
    kfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealqi
    kelchahnvpliindridvamaigadgihvgqddmpipmirklvgmvigwsvgfpeevde
    lskmgpvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgigglhpd
    niervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvniglsslt
    ttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevndlaaipha
    tlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnllltfgqfscikg
    nsseilglaelsnelliqatkivafkyktvavctgefdfiadgtiegkyslstngtsved
    ipcvaveagpigcslgstiacmiggqpsegnlfhavvagvmlykaagkiasekcngsgsf
    qvelidalyrltrentpvtwapkltht
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nm1E (E:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnllltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nm1E (E:)
    kfskeqfdyslylvtdsgmipegktlygqveagngvtlvqirekdadtkffieealqike
    lchahnvpliindridvamaigadgihvgqddmpipmirklvgmvigwsvgfpeevdels
    kmgpvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgigglhpdni
    ervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvniglsslttt
    deiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevndlaaiphatl
    llntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnllltfgqfscikgns
    seilglaelsnelliqatkivafkyktvavctgefdfiadgtiegkyslstngtsvedip
    cvaveagpigcslgstiacmiggqpsegnlfhavvagvmlykaagkiasekcngsgsfqv
    elidalyrltrentpvtwapkltht
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3nm1F (F:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnllltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nm1F (F:)
    kfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealqi
    kelchahnvpliindridvamaigadgihvgqddmpipmirklvgmvigwsvgfpeevde
    lskmgpvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgigglhpd
    niervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvniglsslt
    ttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevndlaaipha
    tlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnllltfgqfscikg
    nsseilglaelsnelliqatkivafkyktvavctgefdfiadgtiegkyslstngtsved
    ipcvaveagpigcslgstiacmiggqpsegnlfhavvagvmlykaagkiasekcngsgsf
    qvelidalyrltrentpvtwapkltht