PDB entry 3nly

View 3nly on RCSB PDB site
Description: Structure of rat neuronal nitric oxide synthase heme domain in complex with 6-(((3R,4R)-4-(2- (2,2-Difluoro-2-(4-fluorophenyl)ethylamino)ethoxy)pyrrolidin-3-yl)methyl)-4-methylpyridin-2-amine
Class: oxidoreductase
Keywords: nitric oxide synthase, heme thiolate enzyme, inhibitor, Oxidoreductase
Deposited on 2010-06-21, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, brain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Nos1, Bnos
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nlya_
  • Chain 'B':
    Compound: Nitric oxide synthase, brain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Nos1, Bnos
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nlyb_
  • Heterogens: HEM, H4B, ACT, 3XC, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nlyA (A:)
    cprflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfp
    lakefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    kg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nlyA (A:)
    rflkvknwetdvvltdtlhlkstletgctehicmgsimlptkdqlfplakefldqyyssi
    krfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgriqwsklqvfda
    rdcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykqpd
    gstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqippelvlevpirhp
    kfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynilee
    vakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyrcr
    ggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nlyB (B:)
    cprflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfp
    lakefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    kg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nlyB (B:)
    rflkvknwetdvvltdtlhlkstletgctehicmgsimlpvrtkdqlfplakefldqyys
    sikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgriqwsklqvf
    dardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykq
    pdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqippelvlevpir
    hpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynil
    eevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyr
    crggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwkg