PDB entry 3nlr

View 3nlr on RCSB PDB site
Description: Structure of neuronal nitric oxide synthase D597N/M336V mutant heme domain in complex with 6-{{(3'R,4'S)-3'-[2"-(3'''-fluorophenethylamino)ethoxy]pyrrolidin-4'-yl}methyl}-4-methylpyridin-2-amine
Class: oxidoreductase
Keywords: nitric oxide synthase, inhibitor, heme enzyme, Oxidoreductase
Deposited on 2010-06-21, released 2010-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, brain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Nos1, Bnos
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29476
      • engineered mutation (39)
      • engineered mutation (300)
    Domains in SCOPe 2.07: d3nlra_
  • Chain 'B':
    Compound: Nitric oxide synthase, brain
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Nos1, Bnos
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29476 (Start-421)
      • engineered mutation (39)
      • engineered mutation (300)
    Domains in SCOPe 2.07: d3nlrb_
  • Heterogens: HEM, H4B, JRS, ACT, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nlrA (A:)
    cprflkvknwetdvvltdtlhlkstletgctehicmgsivlpsqhtrkpedvrtkdqlfp
    lakefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    nycdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    kg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nlrA (A:)
    rflkvknwetdvvltdtlhlkstletgctehicmgsivlptkdqlfplakefldqyyssi
    krfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgriqwsklqvfda
    rdcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykqpd
    gstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqippelvlevpirhp
    kfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrnycdnsrynilee
    vakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyrcr
    ggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nlrB (B:)
    cprflkvknwetdvvltdtlhlkstletgctehicmgsivlpsqhtrkpedvrtkdqlfp
    lakefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    nycdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    kg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nlrB (B:)
    rflkvknwetdvvltdtlhlkstletgctehicmgsivlpvrtkdqlfplakefldqyys
    sikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgriqwsklqvf
    dardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykq
    pdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqippelvlevpir
    hpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrnycdnsrynil
    eevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyr
    crggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwkg