PDB entry 3nll

View 3nll on RCSB PDB site
Description: clostridium beijerinckii flavodoxin mutant: g57a oxidized
Deposited on 1996-12-10, released 1997-03-12
The last revision prior to the SCOP 1.57 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.15
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d3nll__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nll_ (-)
    mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamadev
    leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
    pdeaeqdciefgkkiani