PDB entry 3nlc

View 3nlc on RCSB PDB site
Description: Crystal structure of the VP0956 protein from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR147
Deposited on 2010-06-21, released 2010-08-18
The last revision was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein VP0956
    Species: Vibrio parahaemolyticus [TaxId:670]
    Gene: VP0956
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87R42 (10-End)
      • engineered mutation (244)
  • Heterogens: FAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nlcA (A:)
    mghhhhhhshmirineiklpldheegalldaitkklgipaekvisfnvfrrgydarkktn
    ihliytldiivegdetallakfandphvrqtpdmeykfvakapenlterpivigfgpcgl
    faglvlaqmgfnpiivergkevrertkdtfgfwrkrtlnpesnvqfgeggagtfsdgkly
    sqvkdpnfygrkvitefveagapeeilyvskphigtfklvtmiekmratiielggeirfs
    trvddlhmedgqitgvtlsngeeiksrhvvlavghsardtfemlhergvymeakpfsvgf
    riehkqsmidearfgpnaghpilgaadyklvhhckngrtvysfcmcpggtvvaatseegr
    vvtngmsqysraernansaivvgispevdypgdplagirfqrelesnayklggenydapa
    qkigdflkgrdpsqlgdvepsftpgikltdlskalppfaveaireaipafdrkikgfase
    dglltgvetrtsspvcikrgkdfqsvnlkgfypagegagyaggilsagidgikvaeavar
    divaamena
    

    Sequence, based on observed residues (ATOM records):
    >3nlcA (A:)
    mirineiklpldheegalldaitkklgipaekvisfnvfrrgydarihliytldiivegd
    etallakfandphvrqtpdmeykfvakapenlterpivigfgpcglfaglvlaqmgfnpi
    ivergkevrertkdtfgfwrkrtlnpesnvqfgeggagtfsdgklysqvkdpnfygrkvi
    tefveagapeeilyvskphigtfklvtmiekmratiielggeirfstrvddlhmedgqit
    gvtlsngeeiksrhvvlavghsardtfemlhergvymeakpfsvgfriehkqsmidearf
    gpnaghpilgaadyklvhhckngrtvysfcmcpggtvvaatseegrvvtngmsqysraer
    nansaivvgispevdypgdplagirfqrelesnayklggenydapaqkigdflkgrdpsq
    lgdvepsftpgikltdlskalppfaveaireaipafdrkikgfasedglltgvetrtssp
    vcikrgkdfqsvnlkgfypagegagyaggilsagidgikvaeavardivaamen