PDB entry 3nlb

View 3nlb on RCSB PDB site
Description: Novel kinase profile highlights the temporal basis of context dependent checkpoint pathways to cell death
Class: transferase/transferase inhibitor
Keywords: Kinase Domain, Checkpoint Kinase, ATP Binding, Transferase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-06-21, released 2011-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nlba_
  • Heterogens: 5BE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nlbA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsghhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nlbA (A:)
    vedwdlvqtlgegaygevqlavnrvteeavavkivdmkrenikkeicinkmlnhenvvkf
    yghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrd
    ikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvd
    vwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenp
    saritipdikkdrwynkplkk