PDB entry 3nla

View 3nla on RCSB PDB site
Description: nmr structure of the n-terminal domain with a linker portion of antarctic eel pout antifreeze protein rd3, 40 structures
Class: antifreeze
Keywords: antifreeze protein, thermal hysteresis protein, ice binding protein
Deposited on 1998-02-24, released 1999-02-23
The last revision prior to the SCOP 1.75 freeze date was dated 1999-02-23, with a file datestamp of 2007-06-04.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antifreeze protein rd3 type III
    Species: Rhigophila dearborni
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3nlaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3nlaA (A:)
mnkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdm
vknyedgttspglk

    Sequence, based on observed residues (ATOM records): (download) 
    >3nlaA (A:)
nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
knyedgttspglk