PDB entry 3nl9

View 3nl9 on RCSB PDB site
Description: crystal structure of a putative ntp pyrophosphohydrolase (exig_1061) from exiguobacterium sp. 255-15 at 1.78 a resolution
Deposited on 2010-06-21, released 2010-07-21
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative NTP pyrophosphohydrolase
    Species: Exiguobacterium sibiricum 255-15 [TaxId:262543]
    Gene: Exig_1061
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nl9A (A:)
    gmkqpnyyqdvkqfhqtfhhpgadqptaipldrgvkratwtaeeavveflhqssqnetef
    laaietfkagldqavkkslketypvteverlvgqgdaltdalyfimgsfveaglepgplf
    eivqqanmaklgpdgqpifresdqkvmkpdgwlppepqleaevvrqmkeka
    

    Sequence, based on observed residues (ATOM records):
    >3nl9A (A:)
    kqpnyyqdvkqfhqtfhhpgadqptaipldrgvkratwtaeeavveflhqssqnetefla
    aietfkagldqavkkslketypvteverlvgqgdaltdalyfimgsfveaglepgplfei
    vqqanmaklgpdgqpifresdqkvmkpdgwlppepqleaevvrqmkeka