PDB entry 3nl8

View 3nl8 on RCSB PDB site
Description: Robust computational design, optimization, and structural characterization of retroaldol enzymes
Class: lyase
Keywords: Computationally Designed, Retroaldolase, TimBarrel, LYASE
Deposited on 2010-06-21, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.227
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retro-Aldolase
    Species: artificial gene [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NL8
    Domains in SCOPe 2.07: d3nl8a1, d3nl8a2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nl8A (A:)
    mprylkgwledvvqlslrrpsvrasrqrpiislnerilefnkrnitaiiatymrkspwgl
    dverdpieyakfmeryavglsicteekyangsyetlrkiassvsipilmadfivkesqid
    daynlgadtvplivkiltereleslleyarsygmepiixindendldialrigarfigic
    srdwetleinkenqrklismipsnvvkvastgiserneieelrklgvnafsiisslmrnp
    ekikeliegslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nl8A (A:)
    prylkgwledvvqlslrrpsvrasrqrpiislnerilefnkrnitaiiatymrkspwgld
    verdpieyakfmeryavglsicteekyangsyetlrkiassvsipilmadfivkesqidd
    aynlgadtvplivkiltereleslleyarsygmepiixindendldialrigarfigics
    rdwetleinkenqrklismipsnvvkvastgiserneieelrklgvnafsiisslmrnpe
    kikelieg