PDB entry 3nl5

View 3nl5 on RCSB PDB site
Description: The Crystal Structure of Candida glabrata THI6, a Bifunctional Enzyme involved in Thiamin Biosyhthesis of Eukaryotes
Deposited on 2010-06-21, released 2010-11-10
The last revision was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.206
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, ACP, TZE

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nl5A (A:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnklltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nl5A (A:)
    kfskeqfdyslylvtdsgmipegktlygqveaglqnglvqirekdadtkffieealqike
    lchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpeevde
    lskmgpdmvdyigvgtlfpmgtagairvldalernnahwcrtvgigglhpdniervlyqc
    vssngkrsldgicvvsdiiasldaakstkilrglidktdykfvniglstknsltttdeiq
    siisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevndlaaiphatlllnt
    gsvappemlkaairayndvkrpivfdpvgysatetrlllnnklltfgqfscikgnsseil
    glaelsnelliqatkivafkyktvavctgefdfiadgtiegkyslskgtngtsvedipcv
    aveagpieimgditasgcslgstiacmiggqpsegnlfhavvagvmlykaagkiasekcn
    gsgsfqvelidalyrltrentpvtwapkltht
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nl5B (B:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnklltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nl5B (B:)
    kfskeqfdyslylvtdsgmipegktlygqveaglqnlvqirekdadtkffieealqikel
    chahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpeevdel
    skmgpdmvdyigvgtlfpmgtagairvldalernnahwcrtvgigglhpdniervlyqcv
    ssngkrsldgicvvsdiiasldaakstkilrglidktdykfvniglstknsltttdeiqs
    iisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevndlaaiphatlllntg
    svappemlkaairayndvkpivfdpvgysatetrlllnnklltfgqfscikgnsseilgl
    aelsnelliqatkivafkyktvavctgefdfiadgtiegkyslskgtngtsvedipcvav
    eagpieimgditasgcslgstiacmiggqpsegnlfhavvagvmlykaagkiasekcngs
    gsfqvelidalyrltrentpvtwapkltht
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nl5C (C:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnklltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nl5C (C:)
    kfskeqfdyslylvtdsgmipegktlygqveaglqtlvqirekdadtkffieealqikel
    chahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpeevdel
    skmgpdmvdyigvgtlfpmgtagairvldalernnahwcrtvgigglhpdniervlyqcv
    ssngkrsldgicvvsdiiasldaakstkilrglidktdykfvniglstknsltttdeiqs
    iisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevndlaaiphatlllntg
    svappemlkaairayndvkrpivfdpvgysatetrlllnnklltfgqfscikgnsseilg
    laelsnelliqatkivafkyktvavctgefdfiadgtiegkyslskgtngtsvedipcva
    veagpieimgditasgcslgstiacmiggqpsegnlfhavvagvmlykaagkiasekcng
    sgsfqvelidalyrltrentpvtwapkltht