PDB entry 3nl2

View 3nl2 on RCSB PDB site
Description: the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes
Deposited on 2010-06-21, released 2010-11-10
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3.08 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Thiamine biosynthetic bifunctional enzyme
    Species: Candida glabrata [TaxId:5478]
    Gene: CAGL0E05808g, THI6
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nl2A (A:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnklltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nl2A (A:)
    kfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealqi
    kelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpeev
    delskmgpdmvdyigvgtlfptmgtagairvldalernnahwcrtvgigglhpdniervl
    yqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvniglstknsltttd
    eiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevndlaaiphatll
    lntgsvappemlkaairayndvkrpivfdpvgsatetrlllnnklltfgqfscikgnsse
    ilglaelsnelliqatkivafkyktvavctgefdfiadgtiegkyslskgtngtsvedip
    cvaveagpigcslgstiacmiggqpsegnlfhavvagvmlykaagkiasekcngsgsfqv
    elidalyrltrentpvtwapkltht
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nl2B (B:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnklltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nl2B (B:)
    kfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealqi
    kelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpeev
    delskmgpdmvdyigvgtlfptmgtagairvldalernnahwcrtvgigglhpdniervl
    yqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvniglstknsltttd
    eiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevndlaaiphatll
    lntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnklltfgqfscikgnss
    eilglaelsnelliqatkivafkyktvavctgefdfiadgtiegkyslsgtngtsvedip
    cvaveagpigcslgstiacmiggqpsegnlfhavvagvmlykaagkiasekcngsgsfqv
    elidalyrltrentpvtwapkltht
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nl2C (C:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnklltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nl2C (C:)
    kfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqireadtkffieealqike
    lchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpeevde
    lskmgpdmvdyigvgtlfptmgtagairvldalernnahwcrtvgigglhpdniervlyq
    cvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvniglstknsltttdei
    qsiisntlkarplvqhitnvhqnfganvtlalgsspimseiqsevndlaaiphatlllnt
    gsvappemlkaairayndvkrpivfdpvgystetrlllnnklltfgqfscikgnsseilg
    laelsnelliqatkivafkyktvavctgefdfiadgtiegkyslskgtngtsvedipcva
    vegcslgstiacmiggqpsegnlfhavvagvmlykaagkiasekcngsgsfqvelidaly
    rltrentpvtwapkltht
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nl2D (D:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnklltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nl2D (D:)
    kfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealqi
    kelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpeev
    delskmgpdmvdyigvgtlfptmgtagairvldalernnahwcrtvgigglhpdniervl
    yqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvniglstknsltttd
    eiqsiisntlkarplvqhitnvhqnfganvtlalgsspimseiqsevndlaaiphatlll
    ntgsvappemlkaairayndvkrpivfdpvgsatetrlllnnklltfgqfscikgnssei
    lglaelsnelliqatkivafkyktvavctgefdfiadgtiegkyslskgtngtsvedipc
    vaveagcslgstiacmiggqpsegnlfhavvagvmlykaagkiasekcngsgsfqvelid
    alyrltrentpvtwapkltht
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nl2E (E:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnklltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nl2E (E:)
    kfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealqi
    kelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpeev
    delskmgpdmvdyigvgtlfptmgtagairvldalernnahwcrtvgigglhpdniervl
    yqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvniglstknsltttd
    eiqsiisntlkarplvqhitnvhqnfganvtlalgsspimseiqsevndlaaiphatlll
    ntgsvappemlkaairayndvkrpivfdpvgytetrlllnnklltfgqfscikgnsseil
    glaelsnelliqatkivafkyktvavctgefdfiadgtiegkyslskgtngtsvedipcv
    aveagpigcslgstiacmiggqpsegnlfhavvagvmlykaagkiasekcngsgsfqvel
    idalyrltrentpvtwapkltht
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3nl2F (F:)
    mkfskeqfdyslylvtdsgmipegktlygqveaglqngvtlvqirekdadtkffieealq
    ikelchahnvpliindridvamaigadgihvgqddmpipmirklvgpdmvigwsvgfpee
    vdelskmgpdmvdyigvgtlfptltkknpkkapmgtagairvldalernnahwcrtvgig
    glhpdniervlyqcvssngkrsldgicvvsdiiasldaakstkilrglidktdykfvnig
    lstknsltttdeiqsiisntlkarplvqhitnkvhqnfganvtlalgsspimseiqsevn
    dlaaiphatlllntgsvappemlkaairayndvkrpivfdpvgysatetrlllnnklltf
    gqfscikgnsseilglaelnkermkgvdassgisnelliqatkivafkyktvavctgefd
    fiadgtiegkyslskgtngtsvedipcvaveagpieimgditasgcslgstiacmiggqp
    segnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltrentpvtwapkltht
    

    Sequence, based on observed residues (ATOM records):
    >3nl2F (F:)
    kfskeqfdyslylvtdsgmipegktlygqveaglqngtlvqiradtkffieealqikelc
    hahnvpliindridvamaigadgihvgqddmpipmirklvdmvigwsvgfpeevdelskm
    gpdmvdyigvgtlfpmgtagairvldalernnahwcrtvgigglhpdniervlyqcvssn
    gkrsldgicvvsdiiasldaakstkilrglidktdykfvniglstknsltttdeiqsiis
    ntlkarplvqhitnvhqnfganvtlalgsspimseiqsevndlaaiphatlllntgsvap
    pemlkaairayndvkrpivfdpvgytetrlllnnklltfgqfscikgnsseilglaelsn
    elliqatkivafkyktvavctgefdfiadgtiegkyslskgtngtsvedipcvaveagpi
    slgstiacmiggqpsegnlfhavvagvmlykaagkiasekcngsgsfqvelidalyrltr
    entpvtwapkltht