PDB entry 3nl0

View 3nl0 on RCSB PDB site
Description: Mutant P44S M296I of Foot-and-mouth disease Virus RNA-dependent RNA polymerase
Class: transferase/RNA
Keywords: Foot-and-mouth disease Virus Picornavirus, 3D polymerase, RNA dependent RNA polymerase, TRANSFERASE-RNA complex
Deposited on 2010-06-21, released 2011-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3D polymerase
    Species: Foot-and-mouth disease virus - type C [TaxId:12116]
    Gene: 3D
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QCE4 (0-469)
      • engineered mutation (43)
      • engineered mutation (295)
      • expression tag (470-474)
    Domains in SCOPe 2.07: d3nl0a1, d3nl0a2
  • Chain 'B':
    Compound: 5'-r(p*up*gp*gp*gp*cp*cp*c)-3'
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-r(*g*gp*gp*cp*cp*c)-3'
    Species: synthetic, synthetic
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nl0A (A:)
    glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdsrlnegvvldevifskh
    kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
    walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
    vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
    ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggipsgc
    satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
    gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
    qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaalah
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.